6RXV

Cryo-EM structure of the 90S pre-ribosome (Kre33-Noc4) from Chaetomium thermophilum, state B2


Sequence Similarity Clusters for the Entities in PDB 6RXV

Entity #1 | Chains: UA
Periodic tryptophan protein 2-like protein protein, length: 904 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 12918
95 % 3 7 13298
90 % 3 7 13117
70 % 3 7 12413
50 % 3 11 7398
40 % 3 11 7127
30 % 3 11 6692
Entity #10 | Chains: UM
Utp13 protein, length: 912 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 12513
95 % 3 7 12448
90 % 3 7 12265
70 % 3 7 11653
50 % 3 7 10659
40 % 3 7 10029
30 % 3 7 9279
Entity #11 | Chains: UN
Utp14 protein, length: 938 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 12876
95 % 3 7 13204
90 % 3 7 13016
70 % 3 7 12312
50 % 3 7 11289
40 % 3 7 10616
30 % 3 7 9795
Entity #12 | Chains: UO
Utp15 protein, length: 557 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13103
95 % 3 7 12451
90 % 3 7 12267
70 % 3 7 11778
50 % 3 7 10662
40 % 3 7 10136
30 % 3 9 7858
Entity #13 | Chains: UQ
Utp17 protein, length: 960 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 12514
95 % 3 7 12708
90 % 3 7 12266
70 % 3 7 11654
50 % 3 7 10660
40 % 3 7 10231
30 % 3 7 9280
Entity #14 | Chains: UR
Utp18 protein, length: 618 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13015
95 % 3 7 12430
90 % 3 7 12243
70 % 3 7 11635
50 % 3 7 10639
40 % 3 7 10013
30 % 3 11 6523
Entity #15 | Chains: UU
Utp21 protein, length: 1049 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13337
95 % 3 7 13036
90 % 3 7 12864
70 % 3 7 12175
50 % 3 7 11140
40 % 3 7 10476
30 % 3 7 9678
Entity #16 | Chains: UX
Utp24 protein, length: 193 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 8 11065
95 % 3 8 11491
90 % 3 8 11356
70 % 3 8 10881
50 % 3 12 6905
40 % 3 12 6655
30 % 3 12 6284
Entity #17 | Chains: UZ
Utp30 protein, length: 391 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 12515
95 % 3 7 12449
90 % 3 7 12525
70 % 3 7 11655
50 % 3 7 10661
40 % 3 7 10030
30 % 3 7 9281
Entity #18 | Chains: CA,CB
Nop1 protein, length: 313 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 5317
95 % 3 7 6036
90 % 3 7 6056
70 % 3 7 5963
50 % 3 11 3612
40 % 3 11 3592
30 % 3 11 3513
Entity #19 | Chains: CC
Nop56 protein, length: 523 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13102
95 % 3 7 12579
90 % 3 7 12403
70 % 3 7 11777
50 % 3 11 7196
40 % 3 14 5673
30 % 3 14 5210
Entity #2 | Chains: UB
Utp2 protein, length: 907 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13048
95 % 3 7 12941
90 % 3 7 12307
70 % 3 7 12087
50 % 3 7 10702
40 % 3 7 10064
30 % 3 7 9309
Entity #20 | Chains: CD
Nop58 protein, length: 582 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13533
95 % 3 7 13374
90 % 3 7 13192
70 % 3 7 12501
50 % 3 7 11447
40 % 3 7 10764
30 % 3 7 9927
Entity #21 | Chains: CE,CF
Snu13 protein, length: 127 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 4988
95 % 3 7 6237
90 % 3 7 6250
70 % 3 7 5850
50 % 12 34 1337
40 % 13 35 1317
30 % 12 34 1420
Entity #22 | Chains: CG
Rrp9 protein, length: 630 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13051
95 % 3 7 12641
90 % 3 7 12309
70 % 3 7 11695
50 % 3 7 10706
40 % 3 7 10067
30 % 3 7 9314
Entity #23 | Chains: CH
RNA 3'-terminal phosphate cyclase-like protein protein, length: 411 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 12913
95 % 3 7 13292
90 % 3 7 13108
70 % 3 7 12405
50 % 3 7 11373
40 % 3 7 10694
30 % 3 7 9870
Entity #24 | Chains: CI
Bms1 protein, length: 1163 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13306
95 % 3 7 12987
90 % 3 7 12809
70 % 3 7 12125
50 % 3 7 11097
40 % 3 11 7155
30 % 3 11 6716
Entity #25 | Chains: CJ
Imp3 protein, length: 183 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 8 10822
95 % 3 8 10276
90 % 3 8 10170
70 % 3 8 9834
50 % 3 12 6954
40 % 3 12 6125
30 % 3 12 5822
Entity #26 | Chains: CK
Imp4 protein, length: 297 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 8 9950
95 % 3 8 10693
90 % 3 8 10577
70 % 3 8 10191
50 % 3 11 7432
40 % 3 11 7154
30 % 3 11 6715
Entity #27 | Chains: CL
Mpp10 protein, length: 785 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13039
95 % 3 7 13291
90 % 3 7 12298
70 % 3 7 12404
50 % 3 7 10697
40 % 3 7 10059
30 % 3 7 9868
Entity #28 | Chains: CM
Sof1 protein, length: 446 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13307
95 % 3 7 12988
90 % 3 7 12810
70 % 3 7 12126
50 % 3 7 11098
40 % 3 9 8347
30 % 3 9 7791
Entity #29 | Chains: CN,CO
Emg1 protein, length: 252 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 5339
95 % 3 7 5730
90 % 3 7 6100
70 % 8 17 2343
50 % 8 17 2360
40 % 8 17 2409
30 % 8 17 2399
Entity #3 | Chains: UC
Utp3 protein, length: 648 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 12917
95 % 3 7 13297
90 % 3 7 13116
70 % 3 7 12412
50 % 3 7 11380
40 % 3 7 10699
30 % 3 7 9875
Entity #30 | Chains: CP
KRR1 small subunit processome component protein, length: 322 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 8 9517
95 % 3 8 10021
90 % 3 8 9932
70 % 3 11 7070
50 % 3 11 7010
40 % 3 11 6762
30 % 3 11 6359
Entity #31 | Chains: CQ
Pre-rRNA-processing protein PNO1 protein, length: 259 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13133
95 % 3 7 12637
90 % 3 7 12455
70 % 3 7 11818
50 % 3 7 10819
40 % 3 7 10171
30 % 3 7 9403
Entity #32 | Chains: CR,CS
Kre33 protein, length: 1073 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 8 4346
95 % 3 8 5230
90 % 3 8 5273
70 % 3 8 5228
50 % 3 8 5051
40 % 3 8 4912
30 % 3 8 4730
Entity #33 | Chains: CT
Fcf2 protein, length: 203 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 12665
95 % 3 7 12756
90 % 3 7 12581
70 % 3 7 11938
50 % 3 7 10930
40 % 3 7 10279
30 % 3 7 9499
Entity #34 | Chains: Ca
40S ribosomal protein S1 protein, length: 255 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 5 17927
95 % 3 5 16797
90 % 3 5 16503
70 % 46 86 470
50 % 51 142 350
40 % 53 149 346
30 % 53 149 362
Entity #35 | Chains: Cb
40S ribosomal protein S4 protein, length: 264 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 5 19368
95 % 2 5 17234
90 % 2 5 16910
70 % 50 168 264
50 % 52 178 259
40 % 52 182 260
30 % 52 187 261
Entity #36 | Chains: Cc
40S ribosomal protein s5-like protein protein, length: 212 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 12646
95 % 3 7 12719
90 % 3 7 13028
70 % 8 93 636
50 % 54 188 231
40 % 54 188 240
30 % 54 188 251
Entity #37 | Chains: Cd
40S ribosomal protein S6 protein, length: 239 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 5 19367
95 % 2 5 17411
90 % 2 5 16909
70 % 7 83 713
50 % 51 169 301
40 % 51 174 301
30 % 51 174 323
Entity #38 | Chains: Ce
40S ribosomal protein S7 protein, length: 203 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 12493
95 % 3 7 12405
90 % 3 7 12903
70 % 3 7 11612
50 % 51 175 282
40 % 51 175 294
30 % 53 178 294
Entity #39 | Chains: Cf
40S ribosomal protein S8 protein, length: 202 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 5 20214
95 % 2 5 18663
90 % 2 5 18282
70 % 45 88 459
50 % 52 177 262
40 % 52 181 262
30 % 52 181 283
Entity #4 | Chains: UD
Utp4 protein, length: 884 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 4 8 9242
95 % 4 8 9496
90 % 4 8 9405
70 % 4 8 9136
50 % 4 8 8498
40 % 4 8 8150
30 % 4 8 7605
Entity #40 | Chains: Cg
40S ribosomal protein s9-like protein protein, length: 190 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13243
95 % 3 7 12875
90 % 3 7 12696
70 % 52 172 258
50 % 54 187 232
40 % 54 191 236
30 % 54 191 248
Entity #41 | Chains: Ch
40S ribosomal protein S13-like protein protein, length: 151 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 12808
95 % 3 7 13058
90 % 3 7 12890
70 % 52 177 250
50 % 54 184 238
40 % 54 189 238
30 % 54 189 249
Entity #42 | Chains: Ci
40S ribosomal protein S14-like protein protein, length: 150 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13362
95 % 3 7 13072
90 % 7 73 799
70 % 54 185 219
50 % 54 186 233
40 % 54 186 244
30 % 54 186 262
Entity #43 | Chains: Cj
40S ribosomal protein S16-like protein protein, length: 143 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13110
95 % 3 7 12591
90 % 3 7 12416
70 % 3 7 11696
50 % 54 179 254
40 % 54 183 252
30 % 54 184 269
Entity #44 | Chains: Ck
40S ribosomal protein S11-like protein protein, length: 161 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 5 18667
95 % 2 5 18288
90 % 2 5 17686
70 % 46 90 443
50 % 53 184 236
40 % 53 184 246
30 % 53 184 265
Entity #45 | Chains: Cm
40S ribosomal protein S22-like protein protein, length: 130 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13513
95 % 3 7 12830
90 % 3 7 12646
70 % 53 188 225
50 % 55 191 230
40 % 55 191 237
30 % 414 752 23
Entity #46 | Chains: Cn
40S ribosomal protein s23-like protein protein, length: 145 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13244
95 % 3 7 12876
90 % 3 7 12697
70 % 54 191 210
50 % 54 197 220
40 % 54 197 229
30 % 54 197 243
Entity #47 | Chains: Co
40S ribosomal protein S24 protein, length: 136 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 5 20231
95 % 2 5 18236
90 % 2 5 17372
70 % 45 90 447
50 % 50 179 267
40 % 50 179 282
30 % 50 179 305
Entity #48 | Chains: Cp
40S ribosomal protein S28-like protein protein, length: 68 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13111
95 % 3 7 12592
90 % 3 7 12417
70 % 52 178 248
50 % 54 185 234
40 % 54 186 242
30 % 54 186 258
Entity #49 | Chains: CU
Faf1 protein, length: 311 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13112
95 % 3 7 12593
90 % 3 7 12418
70 % 3 7 11788
50 % 3 7 10785
40 % 3 7 10145
30 % 3 7 9385
Entity #5 | Chains: UF
Utp6 protein, length: 414 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13531
95 % 3 7 12936
90 % 3 7 13239
70 % 3 7 12494
50 % 3 7 11442
40 % 3 7 10758
30 % 3 7 9923
Entity #50 | Chains: C1
35S ribosomal RNA rna, length: 2352 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
Entity #51 | Chains: C2
U3 snoRNA rna, length: 230 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
Entity #52 | Chains: UV
U3 small nucleolar RNA-associated protein 22 protein, length: 1171 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 4 29982
95 % 1 4 22129
90 % 1 4 21543
70 % 1 4 19410
50 % 1 4 17574
40 % 1 4 16216
30 % 1 4 14437
Entity #53 | Chains: CV
Rrp7 protein, length: 322 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 4 25398
95 % 1 4 25613
90 % 1 4 24784
70 % 1 4 22603
50 % 1 4 20084
40 % 1 4 18244
30 % 1 4 16498
Entity #54 | Chains: CW
Ribosome biogenesis protein ENP2 protein, length: 668 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 4 28370
95 % 2 4 23005
90 % 2 4 22370
70 % 2 4 20472
50 % 2 4 18164
40 % 2 4 16715
30 % 2 4 15064
Entity #55 | Chains: UT
Utp20 protein, length: 2612 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 4 30308
95 % 2 4 25867
90 % 2 4 25014
70 % 2 4 22796
50 % 2 4 20082
40 % 2 4 18384
30 % 2 4 16496
Entity #56 | Chains: UH
Utp8 protein, length: 930 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 6 17784
95 % 3 6 16647
90 % 3 6 15089
70 % 3 6 15274
50 % 3 6 13824
40 % 3 6 12863
30 % 3 6 11752
Entity #57 | Chains: UE,UI
Utp5 protein, length: 410 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 6 7103
95 % 3 6 7748
90 % 3 6 7676
70 % 3 6 7483
50 % 3 6 7038
40 % 3 6 6793
30 % 3 6 6402
Entity #58 | Chains: US
Noc4 protein, length: 549 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 6 17783
95 % 3 6 14379
90 % 3 6 16355
70 % 3 6 15273
50 % 3 6 13823
40 % 3 6 12862
30 % 3 6 11751
Entity #59 | Chains: Cl
Rps18 protein, length: 156 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 6 16324
95 % 3 6 14341
90 % 3 6 14121
70 % 52 170 260
50 % 54 179 252
40 % 54 185 245
30 % 54 185 263
Entity #6 | Chains: UG
Utp7 protein, length: 558 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13558
95 % 3 7 13404
90 % 3 7 13223
70 % 3 7 12532
50 % 3 7 11471
40 % 3 9 8106
30 % 3 9 7573
Entity #60 | Chains: CX
Enp1 protein, length: 480 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 6 16325
95 % 3 6 14342
90 % 3 6 14122
70 % 3 6 13330
50 % 3 6 12161
40 % 3 6 11406
30 % 3 14 5378
Entity #61 | Chains: CY
U3 small nucleolar ribonucleoprotein protein lcp5-like protein protein, length: 381 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 3 34938
95 % 2 3 27653
90 % 2 3 26685
70 % 2 3 24209
50 % 2 3 21275
40 % 2 3 19425
30 % 2 3 17425
Entity #62 | Chains: CZ
Bfr2 protein, length: 609 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 4 24873
95 % 2 4 25180
90 % 2 4 24374
70 % 2 4 22242
50 % 2 4 19631
40 % 2 4 18003
30 % 2 4 16159
Entity #63 | Chains: UP
Utp16 protein, length: 364 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 6 16872
95 % 3 6 15223
90 % 3 6 14959
70 % 3 6 14073
50 % 3 6 12818
40 % 3 6 11978
30 % 3 6 10972
Entity #7 | Chains: UJ
UTP10 protein, length: 1802 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 8 10365
95 % 3 8 11317
90 % 3 8 11186
70 % 3 8 10741
50 % 3 8 9905
40 % 3 8 9395
30 % 3 8 8699
Entity #8 | Chains: UK
U3 small nucleolar RNA-associated protein 11 protein, length: 270 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13530
95 % 3 7 13369
90 % 3 7 13186
70 % 3 7 12493
50 % 3 7 11441
40 % 3 7 10757
30 % 3 7 9922
Entity #9 | Chains: UL
Utp12 protein, length: 962 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13529
95 % 3 7 13368
90 % 3 7 13185
70 % 3 7 12492
50 % 3 7 11440
40 % 3 11 6857
30 % 3 11 6524

Instructions

In the table for each entity, view a list of similar sequences by selecting the link associated with the percentage cutoff.



View more detailed documentation on the redundancy reduction and sequence clustering procedure used by RCSB PDB.

You can also use the structure comparison tool to compare any 2 given structures


ACTION - (A) Select for download / view details OR (B) Select two chains for comparison
Rank PDB ID Entity ID Chains Description Details Taxonomy EC Number
1 4V88 16 AO, CO 40S ribosomal protein S14-A 4932
2 4U4R 16 C4, c4 40S ribosomal protein S14-A 4932
3 4U3U 16 C4, c4 40S ribosomal protein S14-A 4932
4 5TBW 63 P, c4 40S ribosomal protein S14-B 4932
5 4U3M 16 C4, c4 40S ribosomal protein S14-A 4932
6 4U3N 16 C4, c4 40S ribosomal protein S14-A 4932
7 4U52 16 C4, c4 40S ribosomal protein S14-A 4932
8 4U4Q 16 C4, c4 40S ribosomal protein S14-A 4932
9 4U6F 16 C4, c4 40S ribosomal protein S14-A 4932
10 4U4U 16 C4, c4 40S ribosomal protein S14-A 4932
11 4U4Z 16 C4, c4 40S ribosomal protein S14-A 4932
12 4U4Y 16 C4, c4 40S ribosomal protein S14-A 4932
13 4U4N 16 C4, c4 40S ribosomal protein S14-A 4932
14 4U55 16 C4, c4 40S ribosomal protein S14-A 4932
15 5DAT 16 C4, c4 40S ribosomal protein S14-A 4932
16 5I4L 16 C4, c4 40S ribosomal protein S14-B 4932
17 4U51 16 C4, c4 40S ribosomal protein S14-A 4932
18 6HHQ 62 P, c4 40S ribosomal protein S14-B 4932
19 5OBM 60 C4, c4 40S ribosomal protein S14-B 4932
20 4U53 16 C4, c4 40S ribosomal protein S14-A 4932
21 5ON6 64 P, c4 40S ribosomal protein S14-B 4932
22 4U50 16 C4, c4 40S ribosomal protein S14-A 4932
23 5NDV 60 C4, c4 40S ribosomal protein S14-B 4932
24 5LYB 16 C4, c4 40S Ribosomal Protein S14 4932
25 4U56 16 C4, c4 40S ribosomal protein S14-A 4932
26 5TGA 16 C4, c4 40S ribosomal protein S14-B 4932
27 5MEI 63 P, c4 40S ribosomal protein S14-B 4932
28 5FCJ 16 C4, c4 40S ribosomal protein S14-A (UNK) residues correspond to residues that aren't well resolved, and for which side-chains could not be modeled. (UNK)s were substituted in the original sequence of the crystallized protein. Remaining misalignments result from differences in the distribution of (UNK)s between the two instances of the molecule in the structure. Here is the original sequence ot the crystallized protein : SNVVQARDNSQVFGVARIYASFNDTFVHVTDLSGKETIARVTGGMKVKADRDESSPYAAMLAAQDVAAKCKEVGITAVHV KIRATGGTRTKTPGPGGQAALRALARSGLRIGRIEDVTPVPSDSTRKKGGRRGRRL 4932
29 4U4O 16 C4, c4 40S ribosomal protein S14-A 4932
30 5DGV 16 C4, c4 40S ribosomal protein S14-A 4932
31 5DGE 16 C4, c4 40S ribosomal protein S14-A 4932
32 5NDW 9 C4, c4 40S ribosomal protein S14-B 4932
33 4BTS 21 AK, BK, CK, DK 40S RIBOSOMAL PROTEIN RPS14E 5911
34 5NDG 16 C4, c4 40S ribosomal protein S14-A 4932
35 5FCI 16 C4, c4 40S ribosomal protein S14-A (UNK) residues correspond to residues that aren't well resolved, and for which side-chains could not be modeled. (UNK)s were substituted in the original sequence of the crystallized protein. Remaining misalignments result from differences in the distribution of (UNK)s between the two instances of the molecule in the structure. Here is the original sequence ot the crystallized protein : SNVVQARDNSQVFGVARIYASFNDTFVHVTDLSGKETIARVTGGMKVKADRDESSPYAAMLAAQDVAAKCKEVGITAVHV KIRATGGTRTKTPGPGGQAALRALARSGLRIGRIEDVTPVPSDSTRKKGGRRGRRL 4932
36 5DC3 16 C4, c4 40S ribosomal protein S14-A 4932
37 5DGF 16 C4, c4 40S ribosomal protein S14-A 4932
38 4V5O 20 AK, BK RPS14E 5911
39 5TGM 16 C4, c4 40S ribosomal protein S14-A 4932
40 4V7R 9 AH, CH 40S ribosomal protein S14-A 4932
41 5VYC 15 O1, O2, O3, O4, O5, O6 40S ribosomal protein S14 9606
42 4KZZ 15 O 40S Ribosomal Protein S14 9986
43 4KZX 15 O 40S ribosomal protein S14 9986
44 4KZY 15 O 40S Ribosomal Protein S14 9986
45 6UZ7 62 O 40S ribosomal protein S14 28985
46 6T83 17 Ob, p 40S ribosomal protein S14-A 4932
47 6T7T 17 SO 40S ribosomal protein S14-A 4932
48 6T7I 17 SO 40S ribosomal protein S14-A 4932
49 6T4Q 16 SO 40S ribosomal protein S14-B 4932
50 6SGC 16 P1 uS11 9986
51 6S47 60 BP 40S ribosomal protein S14-A 4932
52 6RXT 39 Ci 40S ribosomal protein S14-like protein 209285
53 6RXU 42 Ci 40S ribosomal protein S14-like protein 209285
54 6RXV 42 Ci 40S ribosomal protein S14-like protein 209285
55 6RXX 24 Ci 40S ribosomal protein S14-like protein 209285
56 6RXY 38 Ci 40S ribosomal protein S14-like protein 209285
57 6RXZ 41 Ci 40S ribosomal protein S14-like protein 209285
58 6P5I 16 P uS11 9986
59 6P5J 16 P uS11 9986
60 6P5K 62 P uS11 9986
61 6P5N 62 P uS11 9986
62 6P4G 16 P uS11 9986
63 6P4H 17 P uS11 9986
64 6OM7 28 SO 40S ribosomal protein S14 9606
65 6OLZ 61 BO 40S ribosomal protein S14 9606
66 6OM0 28 SO 40S ribosomal protein S14 9606
67 6OLE 28 SO 40S ribosomal protein S14 9606
68 6OLF 28 SO 40S ribosomal protein S14 9606
69 6OLG 64 BO 40S ribosomal protein S14 9606
70 6OLI 28 SO 40S ribosomal protein S14 9606
71 6OKK 16 P 40S ribosomal protein S11 5833
72 6RBD 27 O 40S ribosomal protein S14-A 4932
73 6RBE 12 O 40S ribosomal protein S14-A 4932
74 6R7Q 13 MM uS11 9986
75 6R6G 36 MM 40S ribosomal protein S14 9986
76 6R6P 62 MM uS11 9986
77 6R5Q 66 MM uS11 9986
78 6QZP 75 SO 40S ribosomal protein S14 9606
79 6Q8Y 81 Z 40S ribosomal protein S14-B 4932
80 6I7O 33 Z, Zb 40S ribosomal protein S14-B 4932
81 6IP5 74 3L 40S ribosomal protein S14 9606
82 6IP6 73 3L 40S ribosomal protein S14 9606
83 6IP8 73 3L 40S ribosomal protein S14 9606
84 6MTB 65 OO 40S ribosomal protein S14 9986
85 6MTC 64 OO 40S ribosomal protein S14 9986
86 6MTD 66 OO uS11 9986
87 6MTE 65 OO uS11 9986
88 6HCQ 19 P2 uS11 9986
89 6HCJ 19 P2 uS11 9986
90 6HCM 16 P1 uS11 9986
91 6HCF 16 P1 uS11 9986
92 6GZ3 31 BO ribosomal protein uS11 9986
93 6GZ4 34 BO ribosomal protein uS11 9986
94 6GZ5 31 BO ribosomal protein uS11 9986
95 6GSM 18 O 40S ribosomal protein S14 28985
96 6GSN 38 O 40S ribosomal protein S14 28985
97 6GQV 62 AE 40S ribosomal protein S14-B 4932
98 6GQ1 62 AE 40S ribosomal protein S14-B 4932
99 6GQB 62 AE 40S ribosomal protein S14-B 4932
100 6D9J 64 PP uS11 9986
101 6D90 65 PP uS11 9986
102 6G5H 12 O 40S ribosomal protein S14 9606
103 6G5I 16 O 40S ribosomal protein S14 9606
104 6G4S 27 O 40S ribosomal protein S14 9606
105 6G4W 23 O 40S ribosomal protein S14 9606
106 6G51 13 O 40S ribosomal protein S14 9606
107 6G53 13 O 40S ribosomal protein S14 9606
108 6G18 23 O 40S ribosomal protein S14 9606
109 6FYX 18 O 40S ribosomal protein S14 28985
110 6FYY 18 O 40S ribosomal protein S14 28985
111 6FEC 38 j 40S ribosomal protein S14 9606
112 6FAI 25 O 40S ribosomal protein S14-A 4932
113 6EML 22 Z 40S ribosomal protein S14-A 4932
114 6EK0 75 SO 40S ribosomal protein S14 9606
115 6AZ1 15 O ribosomal protein S11 5661
116 5OQL 42 t 40S ribosomal protein S14-like protein 209285
117 5OPT 14 V 40S ribosomal protein S14, putative 5693
118 5WLC 40 NG rpS14_uS11 4932
119 5XYI 16 O Ribosomal protein S14 5722
120 5XXU 16 O Ribosomal protein uS11 5811
121 5OA3 19 O 40S ribosomal protein S14 9606
122 5WYJ 45 SP 40S ribosomal protein S14-A 4932
123 5WYK 41 SP 40S ribosomal protein S14-A 4932
124 5MC6 27 Z 40S ribosomal protein S14-A 4932
125 5M1J 22 O2 40S ribosomal protein S14-A 4932
126 5LZS 65 OO uS11 9986
127 5LZT 66 OO uS11 9986
128 5LZU 65 OO uS11 9986
129 5LZV 66 OO uS11 9986
130 5LZW 66 OO uS11 9986
131 5LZX 66 OO uS11 9986
132 5LZY 64 OO uS11 9986
133 5LZZ 66 OO uS11 9986
134 5T2A 63 AH uS11 5661
135 5T2C 80 AO 40S ribosomal protein S14 9606
136 5LL6 12 Z 40S ribosomal protein S14-A 4932
137 5LKS 74 SO 40S ribosomal protein S14 9606
138 5K0Y 32 j ribosomal protein uS11 9986
139 5JUO 64 LB uS11 (yeast S14) 4932
140 5JUP 64 LB uS11 (yeast S14) 4932
141 5JUS 64 LB uS11 (yeast S14) 4932
142 5JUT 64 LB uS11 (yeast S14) 4932
143 5JUU 64 LB uS11 (yeast S14) 4932
144 5JPQ 29 w uS11 209285
145 5IT7 62 O 40S ribosomal protein S14 28985
146 5IT9 15 O Ribosomal protein uS14 28985
147 5FLX 16 O 40S RIBOSOMAL PROTEIN S14 9986
148 3JAP 18 O uS11 28985
149 3JAQ 18 O uS11 28985
150 3JAM 16 O uS11 28985
151 3JAN 64 SO Ribosomal protein uS11 SEE REMARK 999 9986
152 3JAJ 65 SO Ribosomal protein uS11 SEE REMARK 999 9986
153 3JAG 66 OO uS11 9986
154 3JAH 66 OO uS11 9986
155 3JAI 66 OO uS11 9986
156 5A2Q 17 O RIBOSOMAL PROTEIN US11 9606
157 4UG0 76 SO 40S RIBOSOMAL PROTEIN S14 9606
158 5AJ0 64 BO 40S ribosomal protein S14 9606
159 4UER 21 K US11 4934
160 4D61 16 O 40S RIBOSOMAL PROTEIN S14 9986
161 4D5L 16 O 40S RIBOSOMAL PROTEIN US11 9986
162 3J81 16 O uS11 28985
163 3J80 12 O uS11 28985
164 3J7P 64 SO Ribosomal protein uS11 9823
165 3J7R 65 SO Ribosomal protein uS11 9823
166 4UJC 65 CO 40S RIBOSOMAL PROTEIN US11 9986
167 4UJD 65 CO 40S RIBOSOMAL PROTEIN ES11 9986
168 3J7A 16 P 40S ribosomal protein uS11 5833
169 3J77 60 14 40S ribosomal protein S14 4932
170 3J78 60 14 40S ribosomal protein S14 4932
171 3J6X 61 14 40S ribosomal protein S14 4932
172 3J6Y 61 14 40S ribosomal protein S14 4932
173 4UJE 19 BO 40S RIBOSOMAL PROTEIN S14 9986
174 4V92 17 BO US11 28985
175 4V7E 16 BO 40S ribosomal protein S11 4565
176 4V8Y 23 AO 40S RIBOSOMAL PROTEIN S14-A 4932
177 4V8Z 23 AO 40S RIBOSOMAL PROTEIN S14-A 4932
178 4V6W 5 AO 40S ribosomal protein S14 7227
179 4V6X 5 AO 40S ribosomal protein S14 9606
180 4V8M 16 AH 40S RIBOSOMAL PROTEIN S14 185431
181 3J0O 12 K Ribosomal protein S14 9986
182 3J0L 12 K Ribosomal protein S14 9986
183 4V6I 12 AK 40S ribosomal protein rpS14 (S11p) 4932
184 4V7H 10 AK 40S ribosomal protein S14(A) 5541
185 4V5Z 18 Ak 40S Ribosomal protein S14e 9612
186 4V4B 11 AK 40S ribosomal protein S14-A 4932