6RXV

Cryo-EM structure of the 90S pre-ribosome (Kre33-Noc4) from Chaetomium thermophilum, state B2


Sequence Similarity Clusters for the Entities in PDB 6RXV

Entity #1 | Chains: UA
Periodic tryptophan protein 2-like protein protein, length: 904 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 14249
95 % 3 7 13651
90 % 3 7 13466
70 % 3 7 12689
50 % 17 25 3310
40 % 17 25 3282
30 % 17 25 3247
Entity #10 | Chains: UM
Utp13 protein, length: 912 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 14453
95 % 3 7 14067
90 % 3 7 14274
70 % 3 7 13067
50 % 3 7 11893
40 % 3 7 11157
30 % 3 7 10302
Entity #11 | Chains: UN
Utp14 protein, length: 938 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13650
95 % 3 7 13681
90 % 3 7 13494
70 % 3 7 12487
50 % 3 7 11592
40 % 3 7 10680
30 % 3 7 9873
Entity #12 | Chains: UO
Utp15 protein, length: 557 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 14447
95 % 3 7 13968
90 % 3 7 13857
70 % 3 7 13051
50 % 3 7 12001
40 % 3 7 11144
30 % 16 22 3640
Entity #13 | Chains: UQ
Utp17 protein, length: 960 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13527
95 % 3 7 13413
90 % 3 7 13495
70 % 3 7 12708
50 % 3 7 11383
40 % 3 7 10882
30 % 3 7 9874
Entity #14 | Chains: UR
Utp18 protein, length: 618 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 14114
95 % 3 7 13397
90 % 3 7 13214
70 % 3 7 12467
50 % 3 7 11369
40 % 3 7 10669
30 % 16 24 3364
Entity #15 | Chains: UU
Utp21 protein, length: 1049 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13944
95 % 3 7 14254
90 % 3 7 14040
70 % 3 7 13216
50 % 3 7 12066
40 % 3 7 11300
30 % 3 7 10428
Entity #16 | Chains: UX
Utp24 protein, length: 193 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 8 13071
95 % 3 8 12396
90 % 3 8 12230
70 % 3 8 11626
50 % 17 26 3270
40 % 17 26 3241
30 % 17 26 3216
Entity #17 | Chains: UZ
Utp30 protein, length: 391 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13760
95 % 3 7 14255
90 % 3 7 14041
70 % 3 7 13217
50 % 3 7 12067
40 % 3 7 11301
30 % 3 7 10429
Entity #18 | Chains: CA,CB
Nop1 protein, length: 313 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 5664
95 % 3 7 6291
90 % 3 7 6324
70 % 3 7 6275
50 % 16 24 1632
40 % 16 24 1672
30 % 16 24 1700
Entity #19 | Chains: CC
Nop56 protein, length: 523 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13759
95 % 3 7 13904
90 % 3 7 13727
70 % 3 7 13215
50 % 16 24 3610
40 % 29 41 1984
30 % 29 41 1995
Entity #2 | Chains: UB
Utp2 protein, length: 907 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 14265
95 % 3 7 14287
90 % 3 7 13504
70 % 3 7 12713
50 % 3 7 11602
40 % 3 7 11329
30 % 3 7 10455
Entity #20 | Chains: CD
Nop58 protein, length: 582 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 14659
95 % 3 7 14466
90 % 3 7 14255
70 % 3 7 13413
50 % 3 7 12311
40 % 3 7 11479
30 % 3 7 10572
Entity #21 | Chains: CE,CF
Snu13 protein, length: 127 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 5818
95 % 3 7 6592
90 % 3 7 6631
70 % 3 7 6550
50 % 25 47 947
40 % 26 48 958
30 % 25 47 1028
Entity #22 | Chains: CG
Rrp9 protein, length: 630 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 14487
95 % 3 7 14137
90 % 3 7 13941
70 % 3 7 12988
50 % 3 7 11970
40 % 3 7 11097
30 % 3 7 10240
Entity #23 | Chains: CH
RNA 3'-terminal phosphate cyclase-like protein protein, length: 411 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13693
95 % 3 7 13782
90 % 3 7 13599
70 % 3 7 12808
50 % 3 7 11678
40 % 3 7 10948
30 % 3 7 10109
Entity #24 | Chains: CI
Bms1 protein, length: 1163 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 14411
95 % 3 7 13987
90 % 3 7 13802
70 % 3 7 12989
50 % 3 7 11843
40 % 18 26 3248
30 % 18 26 3222
Entity #25 | Chains: CJ
Imp3 protein, length: 183 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 8 11716
95 % 3 8 11116
90 % 3 8 12803
70 % 3 8 10575
50 % 17 26 3160
40 % 17 26 3140
30 % 17 26 3114
Entity #26 | Chains: CK
Imp4 protein, length: 297 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 8 11028
95 % 3 8 11844
90 % 3 8 11422
70 % 3 8 11163
50 % 18 26 3269
40 % 18 26 3240
30 % 18 26 3215
Entity #27 | Chains: CL
Mpp10 protein, length: 785 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13755
95 % 3 7 14390
90 % 3 7 13721
70 % 3 7 12907
50 % 3 7 11774
40 % 3 7 11032
30 % 3 7 10185
Entity #28 | Chains: CM
Sof1 protein, length: 446 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 14658
95 % 3 7 13758
90 % 3 7 13575
70 % 3 7 12784
50 % 3 7 12244
40 % 15 21 4037
30 % 15 21 3888
Entity #29 | Chains: CN,CO
Emg1 protein, length: 252 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 5776
95 % 3 7 6337
90 % 3 7 6377
70 % 23 32 1242
50 % 23 32 1278
40 % 23 32 1320
30 % 23 32 1360
Entity #3 | Chains: UC
Utp3 protein, length: 648 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 14007
95 % 3 7 14381
90 % 3 7 14165
70 % 3 7 13323
50 % 3 7 12163
40 % 3 7 11406
30 % 18 23 3595
Entity #30 | Chains: CP
KRR1 small subunit processome component protein, length: 322 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 8 9511
95 % 3 8 10341
90 % 3 8 10250
70 % 10 18 4648
50 % 10 18 4436
40 % 10 18 4359
30 % 10 18 4265
Entity #31 | Chains: CQ
Pre-rRNA-processing protein PNO1 protein, length: 259 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13517
95 % 3 7 13358
90 % 3 7 13213
70 % 3 7 12466
50 % 3 7 11341
40 % 3 7 10668
30 % 3 7 9838
Entity #32 | Chains: CR,CS
Kre33 protein, length: 1073 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 8 4427
95 % 3 8 5290
90 % 3 8 5358
70 % 3 8 5340
50 % 11 16 2618
40 % 11 16 2616
30 % 11 16 2606
Entity #33 | Chains: CT
Fcf2 protein, length: 203 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 14231
95 % 3 7 13610
90 % 3 7 13425
70 % 3 7 12652
50 % 3 7 11543
40 % 3 7 10828
30 % 3 7 10000
Entity #34 | Chains: Ca
40S ribosomal protein S1 protein, length: 255 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 5 19332
95 % 3 5 18094
90 % 3 5 17740
70 % 70 110 424
50 % 72 116 440
40 % 101 197 293
30 % 101 197 307
Entity #35 | Chains: Cb
40S ribosomal protein S4 protein, length: 264 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 5 21475
95 % 2 5 19131
90 % 2 5 18710
70 % 100 218 239
50 % 102 228 235
40 % 102 232 236
30 % 109 244 227
Entity #36 | Chains: Cc
40S ribosomal protein s5-like protein protein, length: 212 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 14230
95 % 3 7 13609
90 % 3 7 13424
70 % 33 118 535
50 % 105 239 219
40 % 105 239 225
30 % 105 239 233
Entity #37 | Chains: Cd
40S ribosomal protein S6 protein, length: 239 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 5 19331
95 % 2 5 18093
90 % 2 5 17739
70 % 32 108 578
50 % 101 219 252
40 % 101 224 250
30 % 101 224 258
Entity #38 | Chains: Ce
40S ribosomal protein S7 protein, length: 203 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 14271
95 % 3 7 13697
90 % 3 7 13517
70 % 3 7 12729
50 % 102 226 243
40 % 102 226 245
30 % 104 229 246
Entity #39 | Chains: Cf
40S ribosomal protein S8 protein, length: 202 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 5 21345
95 % 2 5 19347
90 % 2 5 18899
70 % 70 113 413
50 % 102 227 236
40 % 102 231 237
30 % 102 231 244
Entity #4 | Chains: UD
Utp4 protein, length: 884 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 4 8 10385
95 % 4 8 10853
90 % 4 8 10762
70 % 4 8 10357
50 % 4 8 9628
40 % 4 8 9184
30 % 4 8 8568
Entity #40 | Chains: Cg
40S ribosomal protein s9-like protein protein, length: 190 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 14270
95 % 3 7 13696
90 % 3 7 13516
70 % 103 223 234
50 % 105 238 223
40 % 112 249 217
30 % 112 249 223
Entity #41 | Chains: Ch
40S ribosomal protein S13-like protein protein, length: 151 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 14311
95 % 3 7 13770
90 % 3 7 13587
70 % 103 232 227
50 % 105 235 231
40 % 112 247 218
30 % 112 247 224
Entity #42 | Chains: Ci
40S ribosomal protein S14-like protein protein, length: 150 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 14363
95 % 3 7 13873
90 % 33 99 650
70 % 105 236 218
50 % 105 237 226
40 % 105 237 228
30 % 105 237 235
Entity #43 | Chains: Cj
40S ribosomal protein S16-like protein protein, length: 143 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 14272
95 % 3 7 13698
90 % 3 7 13518
70 % 3 7 12730
50 % 103 228 234
40 % 110 239 227
30 % 110 240 230
Entity #44 | Chains: Ck
40S ribosomal protein S11-like protein protein, length: 161 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 5 20197
95 % 2 5 19499
90 % 2 5 19174
70 % 71 115 396
50 % 103 234 232
40 % 103 234 233
30 % 103 234 241
Entity #45 | Chains: Cm
40S ribosomal protein S22-like protein protein, length: 130 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13866
95 % 3 7 14090
90 % 3 7 13897
70 % 103 238 220
50 % 105 240 222
40 % 113 252 213
30 % 552 896 20
Entity #46 | Chains: Cn
40S ribosomal protein s23-like protein protein, length: 145 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 14338
95 % 3 7 13680
90 % 3 7 13492
70 % 105 242 211
50 % 112 255 204
40 % 112 255 210
30 % 112 255 220
Entity #47 | Chains: Co
40S ribosomal protein S24 protein, length: 136 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 5 20269
95 % 2 5 19500
90 % 2 5 19059
70 % 70 115 401
50 % 100 229 238
40 % 100 229 240
30 % 100 229 250
Entity #48 | Chains: Cp
40S ribosomal protein S28-like protein protein, length: 68 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 14364
95 % 3 7 14207
90 % 3 7 13691
70 % 103 229 229
50 % 112 243 214
40 % 112 244 219
30 % 112 244 226
Entity #49 | Chains: CU
Faf1 protein, length: 311 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 14643
95 % 3 7 14447
90 % 3 7 14230
70 % 3 7 13388
50 % 3 7 12218
40 % 3 7 11454
30 % 3 7 10553
Entity #5 | Chains: UF
Utp6 protein, length: 414 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 14142
95 % 3 7 13458
90 % 3 7 13277
70 % 3 7 12525
50 % 3 7 11416
40 % 3 7 10712
30 % 3 7 9904
Entity #50 | Chains: C1
35S ribosomal RNA rna, length: 2352 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
Entity #51 | Chains: C2
U3 snoRNA rna, length: 230 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
Entity #52 | Chains: UV
U3 small nucleolar RNA-associated protein 22 protein, length: 1171 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 4 27179
95 % 1 4 27505
90 % 1 4 26569
70 % 1 4 24132
50 % 1 4 21166
40 % 1 4 19359
30 % 1 4 17345
Entity #53 | Chains: CV
Rrp7 protein, length: 322 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 4 29340
95 % 1 4 23223
90 % 1 4 22609
70 % 1 4 23610
50 % 1 4 20752
40 % 1 4 16849
30 % 1 4 15223
Entity #54 | Chains: CW
Ribosome biogenesis protein ENP2 protein, length: 668 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 4 32214
95 % 2 4 25089
90 % 2 4 24324
70 % 2 4 22143
50 % 2 4 19529
40 % 2 4 17904
30 % 2 4 17163
Entity #55 | Chains: UT
Utp20 protein, length: 2612 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 4 30336
95 % 2 4 24149
90 % 2 4 23883
70 % 2 4 21751
50 % 2 4 18935
40 % 2 4 17614
30 % 2 4 15894
Entity #56 | Chains: UH
Utp8 protein, length: 930 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 6 16982
95 % 3 6 18063
90 % 3 6 17708
70 % 3 6 16302
50 % 3 6 14781
40 % 3 6 13711
30 % 3 6 12495
Entity #57 | Chains: UE,UI
Utp5 protein, length: 410 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 6 7768
95 % 3 6 8365
90 % 3 6 8337
70 % 3 6 8115
50 % 3 6 7455
40 % 3 6 7350
30 % 3 6 6910
Entity #58 | Chains: US
Noc4 protein, length: 549 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 6 18374
95 % 3 6 15811
90 % 3 6 16362
70 % 3 6 15258
50 % 3 6 13230
40 % 3 6 12856
30 % 3 6 11157
Entity #59 | Chains: Cl
Rps18 protein, length: 156 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 6 18112
95 % 3 6 16536
90 % 3 6 16225
70 % 98 215 241
50 % 100 224 239
40 % 107 236 230
30 % 107 237 237
Entity #6 | Chains: UG
Utp7 protein, length: 558 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 14266
95 % 3 7 13689
90 % 3 7 13505
70 % 3 7 12714
50 % 3 7 11603
40 % 15 21 4019
30 % 15 21 3932
Entity #60 | Chains: CX
Enp1 protein, length: 480 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 6 17051
95 % 3 6 14627
90 % 3 6 14417
70 % 3 6 13569
50 % 3 6 12389
40 % 3 6 11610
30 % 18 29 2808
Entity #61 | Chains: CY
U3 small nucleolar ribonucleoprotein protein lcp5-like protein protein, length: 381 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 3 36066
95 % 2 3 28364
90 % 2 3 26741
70 % 2 3 24273
50 % 2 3 21300
40 % 2 3 19472
30 % 2 3 17454
Entity #62 | Chains: CZ
Bfr2 protein, length: 609 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 4 30337
95 % 2 4 25334
90 % 2 4 24559
70 % 2 4 21752
50 % 2 4 19215
40 % 2 4 17615
30 % 2 4 15895
Entity #63 | Chains: UP
Utp16 protein, length: 364 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 6 16728
95 % 3 6 17709
90 % 3 6 15936
70 % 3 6 16113
50 % 3 6 14515
40 % 3 6 13490
30 % 3 6 12304
Entity #7 | Chains: UJ
UTP10 protein, length: 1802 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 8 13427
95 % 3 8 13232
90 % 3 8 12494
70 % 3 8 12327
50 % 3 8 11243
40 % 3 8 10564
30 % 3 8 9768
Entity #8 | Chains: UK
U3 small nucleolar RNA-associated protein 11 protein, length: 270 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 14008
95 % 3 7 14382
90 % 3 7 14166
70 % 3 7 13324
50 % 3 7 12164
40 % 3 7 11407
30 % 3 7 10515
Entity #9 | Chains: UL
Utp12 protein, length: 962 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 14687
95 % 3 7 14503
90 % 3 7 14300
70 % 3 7 13445
50 % 3 7 12278
40 % 17 25 3302
30 % 17 25 3237

Instructions

In the table for each entity, view a list of similar sequences by selecting the link associated with the percentage cutoff.



View more detailed documentation on the redundancy reduction and sequence clustering procedure used by RCSB PDB.

You can also use the structure comparison tool to compare any 2 given structures


ACTION - (A) Select for download / view details OR (B) Select two chains for comparison
Rank PDB ID Entity ID Chains Description Details Taxonomy EC Number
1 4V88 16 AO, CO 40S ribosomal protein S14-A 4932
2 4U4R 16 C4, c4 40S ribosomal protein S14-A 4932
3 4U3U 16 C4, c4 40S ribosomal protein S14-A 4932
4 5TBW 63 P, c4 40S ribosomal protein S14-B 4932
5 4U3M 16 C4, c4 40S ribosomal protein S14-A 4932
6 4U3N 16 C4, c4 40S ribosomal protein S14-A 4932
7 4U52 16 C4, c4 40S ribosomal protein S14-A 4932
8 4U4Q 16 C4, c4 40S ribosomal protein S14-A 4932
9 4U6F 16 C4, c4 40S ribosomal protein S14-A 4932
10 4U4U 16 C4, c4 40S ribosomal protein S14-A 4932
11 4U4Z 16 C4, c4 40S ribosomal protein S14-A 4932
12 4U4Y 16 C4, c4 40S ribosomal protein S14-A 4932
13 4U4N 16 C4, c4 40S ribosomal protein S14-A 4932
14 4U55 16 C4, c4 40S ribosomal protein S14-A 4932
15 5DAT 16 C4, c4 40S ribosomal protein S14-A 4932
16 5I4L 16 C4, c4 40S ribosomal protein S14-B 4932
17 4U51 16 C4, c4 40S ribosomal protein S14-A 4932
18 6HHQ 62 P, c4 40S ribosomal protein S14-B 4932
19 5OBM 60 C4, c4 40S ribosomal protein S14-B 4932
20 4U53 16 C4, c4 40S ribosomal protein S14-A 4932
21 5ON6 64 P, c4 40S ribosomal protein S14-B 4932
22 4U50 16 C4, c4 40S ribosomal protein S14-A 4932
23 5NDV 60 C4, c4 40S ribosomal protein S14-B 4932
24 5LYB 16 C4, c4 40S Ribosomal Protein S14 4932
25 4U56 16 C4, c4 40S ribosomal protein S14-A 4932
26 5TGA 16 C4, c4 40S ribosomal protein S14-B 4932
27 5MEI 63 P, c4 40S ribosomal protein S14-B 4932
28 5FCJ 16 C4, c4 40S ribosomal protein S14-A (UNK) residues correspond to residues that aren't well resolved, and for which side-chains could not be modeled. (UNK)s were substituted in the original sequence of the crystallized protein. Remaining misalignments result from differences in the distribution of (UNK)s between the two instances of the molecule in the structure. Here is the original sequence ot the crystallized protein : SNVVQARDNSQVFGVARIYASFNDTFVHVTDLSGKETIARVTGGMKVKADRDESSPYAAMLAAQDVAAKCKEVGITAVHV KIRATGGTRTKTPGPGGQAALRALARSGLRIGRIEDVTPVPSDSTRKKGGRRGRRL 4932
29 4U4O 16 C4, c4 40S ribosomal protein S14-A 4932
30 5DGV 16 C4, c4 40S ribosomal protein S14-A 4932
31 5DGE 16 C4, c4 40S ribosomal protein S14-A 4932
32 5NDW 9 C4, c4 40S ribosomal protein S14-B 4932
33 4BTS 21 AK, BK, CK, DK 40S RIBOSOMAL PROTEIN RPS14E 5911
34 5NDG 16 C4, c4 40S ribosomal protein S14-A 4932
35 5FCI 16 C4, c4 40S ribosomal protein S14-A (UNK) residues correspond to residues that aren't well resolved, and for which side-chains could not be modeled. (UNK)s were substituted in the original sequence of the crystallized protein. Remaining misalignments result from differences in the distribution of (UNK)s between the two instances of the molecule in the structure. Here is the original sequence ot the crystallized protein : SNVVQARDNSQVFGVARIYASFNDTFVHVTDLSGKETIARVTGGMKVKADRDESSPYAAMLAAQDVAAKCKEVGITAVHV KIRATGGTRTKTPGPGGQAALRALARSGLRIGRIEDVTPVPSDSTRKKGGRRGRRL 4932
36 5DC3 16 C4, c4 40S ribosomal protein S14-A 4932
37 5DGF 16 C4, c4 40S ribosomal protein S14-A 4932
38 4V5O 20 AK, BK RPS14E 5911
39 5TGM 16 C4, c4 40S ribosomal protein S14-A 4932
40 4V7R 9 AH, CH 40S ribosomal protein S14-A 4932
41 5VYC 15 O1, O2, O3, O4, O5, O6 40S ribosomal protein S14 9606
42 4KZZ 15 O 40S Ribosomal Protein S14 9986
43 4KZX 15 O 40S ribosomal protein S14 9986
44 4KZY 15 O 40S Ribosomal Protein S14 9986
45 6ZVH 28 O 40S ribosomal protein S14 9606
46 6ZVI 37 w 40S ribosomal protein S14-B 4932
47 6ZQA 48 DO 40S ribosomal protein S14-A 4932
48 6ZQB 57 DO 40S ribosomal protein S14-A 4932
49 6ZQC 57 DO 40S ribosomal protein S14-A 4932
50 6ZQD 53 DO 40S ribosomal protein S14-A 4932
51 6ZQE 49 DO 40S ribosomal protein S14-A 4932
52 6ZQF 35 DO 40S ribosomal protein S14-A 4932
53 6ZQG 27 DO 40S ribosomal protein S14-A 4932
54 6ZP4 34 i 40S ribosomal protein S14 9606
55 6ZOJ 16 O 40S ribosomal protein S14 9606
56 6ZOK 12 O 40S ribosomal protein S14 9606
57 6ZON 13 i 40S ribosomal protein S14 9606
58 6ZN5 15 P 40S ribosomal protein S14 9606
59 6ZMW 17 P 40S ribosomal protein S14 9606
60 6ZMO 76 SO 40S ribosomal protein S14 9606
61 6ZMT 15 P 40S ribosomal protein S14 9606
62 6ZME 76 SO 40S ribosomal protein S14 9606
63 6ZMI 76 SO 40S ribosomal protein S14 9606
64 6ZLW 15 P 40S ribosomal protein S14 9606
65 6ZM7 76 SO 40S ribosomal protein S14 9606
66 6XIQ 61 AE 40S ribosomal protein S14-B 4932
67 6XIR 58 AE 40S ribosomal protein S14-B 4932
68 6Z6J 20 SO 40S ribosomal protein S14-A 4932
69 6Z6K 20 SO 40S ribosomal protein S14-A 4932
70 6Z6L 74 SO 40S ribosomal protein S14 9606
71 6Z6M 74 SO 40S ribosomal protein S14 9606
72 6Z6N 74 SO 40S ribosomal protein S14 9606
73 6WOO 62 OO uS11 4932
74 6YBW 15 P 40S ribosomal protein S14 9606
75 6YBD 15 P 40S ribosomal protein S14 9606
76 6YAL 17 Q 40S ribosomal protein uS11 9986
77 6YAM 17 Q 40S ribosomal protein uS11 9986
78 6YAN 16 Q 40S ribosomal protein uS11 9986
79 6W2S 13 P uS11 9986
80 6W2T 12 P uS11 9986
81 6Y7C 14 O 40S ribosomal protein S14-A 4932
82 6Y57 63 SO 40S ribosomal protein S14 9606
83 6Y2L 63 SO 40S ribosomal protein S14 9606
84 6Y0G 64 SO 40S ribosomal protein S14 9606
85 6LQP 14 SP 40S ribosomal protein S14-A 4932
86 6LQQ 13 SP 40S ribosomal protein S14-A 4932
87 6LQR 13 SP 40S ribosomal protein S14-A 4932
88 6LQS 13 SP 40S ribosomal protein S14-A 4932
89 6LQT 13 SP 40S ribosomal protein S14-A 4932
90 6LQU 13 SP 40S ribosomal protein S14-A 4932
91 6TNU 18 Z 40S ribosomal protein S14-B 4932
92 6UZ7 62 O 40S ribosomal protein S14 28985
93 6TB3 18 Z 40S ribosomal protein S14-B 4932
94 6T83 17 Ob, p 40S ribosomal protein S14-A 4932
95 6T7T 19 SO 40S ribosomal protein S14-B 4932
96 6T7I 17 SO 40S ribosomal protein S14-A 4932
97 6T4Q 16 SO 40S ribosomal protein S14-B 4932
98 6SV4 33 Z, Zb, Zc 40S ribosomal protein S14-A 4932
99 6SNT 17 O 40S ribosomal protein S14-A 4932
100 6SGC 16 P1 uS11 9986
101 6KE6 14 SP 40S ribosomal protein S14-A 4932
102 6S47 60 BP 40S ribosomal protein S14-A 4932
103 6RXT 39 Ci 40S ribosomal protein S14-like protein 209285
104 6RXU 42 Ci 40S ribosomal protein S14-like protein 209285
105 6RXV 42 Ci 40S ribosomal protein S14-like protein 209285
106 6RXX 24 Ci 40S ribosomal protein S14-like protein 209285
107 6RXY 38 Ci 40S ribosomal protein S14-like protein 209285
108 6RXZ 41 Ci 40S ribosomal protein S14-like protein 209285
109 6P5I 16 P uS11 9986
110 6P5J 16 P uS11 9986
111 6P5K 62 P uS11 9986
112 6P5N 62 P uS11 9986
113 6P4G 16 P uS11 9986
114 6P4H 17 P uS11 9986
115 6OM7 28 SO 40S ribosomal protein S14 9606
116 6OLZ 61 BO 40S ribosomal protein S14 9606
117 6OM0 28 SO 40S ribosomal protein S14 9606
118 6OLE 28 SO 40S ribosomal protein S14 9606
119 6OLF 28 SO 40S ribosomal protein S14 9606
120 6OLG 64 BO 40S ribosomal protein S14 9606
121 6OLI 28 SO 40S ribosomal protein S14 9606
122 6OKK 16 P 40S ribosomal protein S11 5833
123 6RBD 27 O 40S ribosomal protein S14-A 4932
124 6RBE 12 O 40S ribosomal protein S14-A 4932
125 6R7Q 13 MM uS11 9986
126 6R6G 36 MM 40S ribosomal protein S14 9986
127 6R6P 62 MM uS11 9986
128 6R5Q 66 MM uS11 9986
129 6QZP 75 SO 40S ribosomal protein S14 9606
130 6Q8Y 81 Z 40S ribosomal protein S14-B 4932
131 6I7O 33 Z, Zb 40S ribosomal protein S14-B 4932
132 6IP5 74 3L 40S ribosomal protein S14 9606
133 6IP6 73 3L 40S ribosomal protein S14 9606
134 6IP8 73 3L 40S ribosomal protein S14 9606
135 6MTB 65 OO 40S ribosomal protein S14 9986
136 6MTC 64 OO 40S ribosomal protein S14 9986
137 6MTD 66 OO uS11 9986
138 6MTE 65 OO uS11 9986
139 6HCQ 19 P2 uS11 9986
140 6HCJ 19 P2 uS11 9986
141 6HCM 16 P1 uS11 9986
142 6HCF 16 P1 uS11 9986
143 6GZ3 31 BO ribosomal protein uS11 9986
144 6GZ4 34 BO ribosomal protein uS11 9986
145 6GZ5 31 BO ribosomal protein uS11 9986
146 6GSM 18 O 40S ribosomal protein S14 28985
147 6GSN 38 O 40S ribosomal protein S14 28985
148 6GQV 62 AE 40S ribosomal protein S14-B 4932
149 6GQ1 62 AE 40S ribosomal protein S14-B 4932
150 6GQB 62 AE 40S ribosomal protein S14-B 4932
151 6D9J 64 PP uS11 9986
152 6D90 65 PP uS11 9986
153 6G5H 12 O 40S ribosomal protein S14 9606
154 6G5I 16 O 40S ribosomal protein S14 9606
155 6G4S 27 O 40S ribosomal protein S14 9606
156 6G4W 23 O 40S ribosomal protein S14 9606
157 6G51 13 O 40S ribosomal protein S14 9606
158 6G53 13 O 40S ribosomal protein S14 9606
159 6G18 23 O 40S ribosomal protein S14 9606
160 6FYX 18 O 40S ribosomal protein S14 28985
161 6FYY 18 O 40S ribosomal protein S14 28985
162 6FEC 38 j 40S ribosomal protein S14 9606
163 6FAI 25 O 40S ribosomal protein S14-A 4932
164 6EML 22 Z 40S ribosomal protein S14-A 4932
165 6EK0 75 SO 40S ribosomal protein S14 9606
166 6AZ1 15 O ribosomal protein S11 5661
167 5OQL 42 t 40S ribosomal protein S14-like protein 209285
168 5OPT 14 V 40S ribosomal protein S14, putative 5693
169 5WLC 40 NG rpS14_uS11 4932
170 5XYI 16 O Ribosomal protein S14 5722
171 5XXU 16 O Ribosomal protein uS11 5811
172 5OA3 19 O 40S ribosomal protein S14 9606
173 5WYJ 45 SP 40S ribosomal protein S14-A 4932
174 5WYK 41 SP 40S ribosomal protein S14-A 4932
175 5MC6 27 Z 40S ribosomal protein S14-A 4932
176 5M1J 22 O2 40S ribosomal protein S14-A 4932
177 5LZS 65 OO uS11 9986
178 5LZT 66 OO uS11 9986
179 5LZU 65 OO uS11 9986
180 5LZV 66 OO uS11 9986
181 5LZW 66 OO uS11 9986
182 5LZX 66 OO uS11 9986
183 5LZY 64 OO uS11 9986
184 5LZZ 66 OO uS11 9986
185 5T2A 63 AH uS11 5661
186 5T2C 80 AO 40S ribosomal protein S14 9606
187 5LL6 12 Z 40S ribosomal protein S14-A 4932
188 5LKS 74 SO 40S ribosomal protein S14 9606
189 5K0Y 32 j ribosomal protein uS11 9986
190 5JUO 64 LB uS11 (yeast S14) 4932
191 5JUP 64 LB uS11 (yeast S14) 4932
192 5JUS 64 LB uS11 (yeast S14) 4932
193 5JUT 64 LB uS11 (yeast S14) 4932
194 5JUU 64 LB uS11 (yeast S14) 4932
195 5JPQ 29 w uS11 209285
196 5IT7 62 O 40S ribosomal protein S14 28985
197 5IT9 15 O Ribosomal protein uS14 28985
198 5FLX 16 O 40S RIBOSOMAL PROTEIN S14 9986
199 3JAP 18 O uS11 28985
200 3JAQ 18 O uS11 28985
201 3JAM 16 O uS11 28985
202 3JAN 64 SO Ribosomal protein uS11 SEE REMARK 999 9986
203 3JAJ 65 SO Ribosomal protein uS11 SEE REMARK 999 9986
204 3JAG 66 OO uS11 9986
205 3JAH 66 OO uS11 9986
206 3JAI 66 OO uS11 9986
207 5A2Q 17 O RIBOSOMAL PROTEIN US11 9606
208 4UG0 76 SO 40S RIBOSOMAL PROTEIN S14 9606
209 5AJ0 64 BO 40S ribosomal protein S14 9606
210 4UER 21 K US11 4934
211 4D61 16 O 40S RIBOSOMAL PROTEIN S14 9986
212 4D5L 16 O 40S RIBOSOMAL PROTEIN US11 9986
213 3J81 16 O uS11 28985
214 3J80 12 O uS11 28985
215 3J7P 64 SO Ribosomal protein uS11 9823
216 3J7R 65 SO Ribosomal protein uS11 9823
217 4UJC 65 CO 40S RIBOSOMAL PROTEIN US11 9986
218 4UJD 65 CO 40S RIBOSOMAL PROTEIN ES11 9986
219 3J7A 16 P 40S ribosomal protein uS11 5833
220 3J77 60 14 40S ribosomal protein S14 4932
221 3J78 60 14 40S ribosomal protein S14 4932
222 3J6X 61 14 40S ribosomal protein S14 4932
223 3J6Y 61 14 40S ribosomal protein S14 4932
224 4UJE 19 BO 40S RIBOSOMAL PROTEIN S14 9986
225 4V92 17 BO US11 28985
226 4V7E 16 BO 40S ribosomal protein S11 4565
227 4V8Y 23 AO 40S RIBOSOMAL PROTEIN S14-A 4932
228 4V8Z 23 AO 40S RIBOSOMAL PROTEIN S14-A 4932
229 4V6W 5 AO 40S ribosomal protein S14 7227
230 4V6X 5 AO 40S ribosomal protein S14 9606
231 4V8M 16 AH 40S RIBOSOMAL PROTEIN S14 185431
232 3J0O 12 K Ribosomal protein S14 9986
233 3J0L 12 K Ribosomal protein S14 9986
234 4V6I 12 AK 40S ribosomal protein rpS14 (S11p) 4932
235 4V7H 10 AK 40S ribosomal protein S14(A) 5541
236 4V5Z 18 Ak 40S Ribosomal protein S14e 9612
237 4V4B 11 AK 40S ribosomal protein S14-A 4932