6RXV

Cryo-EM structure of the 90S pre-ribosome (Kre33-Noc4) from Chaetomium thermophilum, state B2


Sequence Similarity Clusters for the Entities in PDB 6RXV

Entity #1 | Chains: UA
Periodic tryptophan protein 2-like protein protein, length: 904 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 12861
95 % 3 7 12852
90 % 3 7 12671
70 % 3 7 12057
50 % 3 11 7281
40 % 3 11 7016
30 % 3 11 6562
Entity #10 | Chains: UM
Utp13 protein, length: 912 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13648
95 % 3 7 13292
90 % 3 7 13116
70 % 3 7 12797
50 % 3 7 11359
40 % 3 7 10679
30 % 3 7 9855
Entity #11 | Chains: UN
Utp14 protein, length: 938 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13160
95 % 3 7 13460
90 % 3 7 13271
70 % 3 7 12597
50 % 3 7 11492
40 % 3 7 10803
30 % 3 7 9969
Entity #12 | Chains: UO
Utp15 protein, length: 557 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13642
95 % 3 7 13280
90 % 3 7 13106
70 % 3 7 12452
50 % 3 7 11357
40 % 3 7 10662
30 % 3 9 7870
Entity #13 | Chains: UQ
Utp17 protein, length: 960 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13161
95 % 3 7 13158
90 % 3 7 12974
70 % 3 7 12337
50 % 3 7 11493
40 % 3 7 10560
30 % 3 7 9970
Entity #14 | Chains: UR
Utp18 protein, length: 618 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 12778
95 % 3 7 13218
90 % 3 7 12505
70 % 3 7 11901
50 % 3 7 10863
40 % 3 7 10208
30 % 3 11 6594
Entity #15 | Chains: UU
Utp21 protein, length: 1049 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13159
95 % 3 7 13459
90 % 3 7 13270
70 % 3 7 12596
50 % 3 7 11491
40 % 3 7 10802
30 % 3 7 9968
Entity #16 | Chains: UX
Utp24 protein, length: 193 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 8 12330
95 % 3 8 11681
90 % 3 8 12372
70 % 3 8 11079
50 % 3 12 7038
40 % 3 12 6802
30 % 3 12 6391
Entity #17 | Chains: UZ
Utp30 protein, length: 391 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 12779
95 % 3 7 12681
90 % 3 7 12506
70 % 3 7 11902
50 % 3 7 10864
40 % 3 7 10209
30 % 3 7 9434
Entity #18 | Chains: CA,CB
Nop1 protein, length: 313 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 5265
95 % 3 7 5836
90 % 3 7 5869
70 % 3 7 5803
50 % 3 11 3692
40 % 3 11 3668
30 % 3 11 3574
Entity #19 | Chains: CC
Nop56 protein, length: 523 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 12995
95 % 3 7 13146
90 % 3 7 13380
70 % 3 7 12706
50 % 3 11 7228
40 % 3 15 5166
30 % 3 15 4937
Entity #2 | Chains: UB
Utp2 protein, length: 907 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13850
95 % 3 7 13647
90 % 3 7 13010
70 % 3 7 12824
50 % 3 7 11666
40 % 3 7 11006
30 % 3 7 10150
Entity #20 | Chains: CD
Nop58 protein, length: 582 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13846
95 % 3 7 13699
90 % 3 7 13505
70 % 3 7 12813
50 % 3 7 11710
40 % 3 7 10996
30 % 3 7 10141
Entity #21 | Chains: CE,CF
Snu13 protein, length: 127 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 5532
95 % 3 7 6310
90 % 3 7 6132
70 % 3 7 6065
50 % 12 34 1391
40 % 13 35 1372
30 % 12 34 1463
Entity #22 | Chains: CG
Rrp9 protein, length: 630 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13140
95 % 3 7 13417
90 % 3 7 13234
70 % 3 7 12558
50 % 3 7 11455
40 % 3 7 10762
30 % 3 7 9937
Entity #23 | Chains: CH
RNA 3'-terminal phosphate cyclase-like protein protein, length: 411 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13823
95 % 3 7 13656
90 % 3 7 13042
70 % 3 7 12398
50 % 3 7 11674
40 % 3 7 10613
30 % 3 7 10116
Entity #24 | Chains: CI
Bms1 protein, length: 1163 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13688
95 % 3 7 12829
90 % 3 7 12523
70 % 3 7 12538
50 % 3 7 10881
40 % 3 11 7278
30 % 3 11 6824
Entity #25 | Chains: CJ
Imp3 protein, length: 183 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 8 10847
95 % 3 8 11965
90 % 3 8 11815
70 % 3 8 11288
50 % 3 12 6973
40 % 3 12 6747
30 % 3 12 6343
Entity #26 | Chains: CK
Imp4 protein, length: 297 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 8 10846
95 % 3 8 11964
90 % 3 8 12228
70 % 3 8 11641
50 % 3 11 7381
40 % 3 11 7113
30 % 3 11 6648
Entity #27 | Chains: CL
Mpp10 protein, length: 785 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 12996
95 % 3 7 13147
90 % 3 7 12964
70 % 3 7 12331
50 % 3 7 11252
40 % 3 7 10557
30 % 3 7 9758
Entity #28 | Chains: CM
Sof1 protein, length: 446 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13822
95 % 3 7 13655
90 % 3 7 12843
70 % 3 7 12835
50 % 3 7 11673
40 % 3 9 8780
30 % 3 9 7810
Entity #29 | Chains: CN,CO
Emg1 protein, length: 252 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 5458
95 % 3 7 6195
90 % 3 7 6210
70 % 8 17 2327
50 % 8 17 2427
40 % 8 17 2438
30 % 8 17 2428
Entity #3 | Chains: UC
Utp3 protein, length: 648 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13375
95 % 3 7 12766
90 % 3 7 13382
70 % 3 7 12708
50 % 3 7 11599
40 % 3 7 10896
30 % 3 7 10057
Entity #30 | Chains: CP
KRR1 small subunit processome component protein, length: 322 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 8 9731
95 % 3 8 9849
90 % 3 8 9761
70 % 3 11 7112
50 % 3 11 6775
40 % 3 11 6905
30 % 3 11 6468
Entity #31 | Chains: CQ
Pre-rRNA-processing protein PNO1 protein, length: 259 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 12755
95 % 3 7 12667
90 % 3 7 12463
70 % 3 7 11886
50 % 3 7 10824
40 % 3 7 10176
30 % 3 7 9421
Entity #32 | Chains: CR,CS
Kre33 protein, length: 1073 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 8 4621
95 % 3 8 5103
90 % 3 8 5168
70 % 3 8 5281
50 % 3 8 4980
40 % 3 8 5071
30 % 3 8 4680
Entity #33 | Chains: CT
Fcf2 protein, length: 203 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 12754
95 % 3 7 13488
90 % 3 7 12462
70 % 3 7 12625
50 % 3 7 10849
40 % 3 7 10271
30 % 3 7 9420
Entity #34 | Chains: Ca
40S ribosomal protein S1 protein, length: 255 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 5 18601
95 % 3 5 17692
90 % 3 5 17378
70 % 49 89 457
50 % 56 147 351
40 % 58 154 351
30 % 58 154 366
Entity #35 | Chains: Cb
40S ribosomal protein S4 protein, length: 264 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 5 18247
95 % 2 5 17117
90 % 2 5 16828
70 % 56 174 261
50 % 58 184 254
40 % 58 188 258
30 % 62 197 255
Entity #36 | Chains: Cc
40S ribosomal protein s5-like protein protein, length: 212 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 12907
95 % 3 7 12946
90 % 3 7 12766
70 % 11 96 627
50 % 60 194 231
40 % 60 194 245
30 % 60 194 259
Entity #37 | Chains: Cd
40S ribosomal protein S6 protein, length: 239 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 5 18282
95 % 2 5 17184
90 % 2 5 16850
70 % 10 86 705
50 % 57 175 300
40 % 57 180 292
30 % 57 180 316
Entity #38 | Chains: Ce
40S ribosomal protein S7 protein, length: 203 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 12908
95 % 3 7 12947
90 % 3 7 12767
70 % 3 7 12692
50 % 57 181 273
40 % 57 181 286
30 % 59 184 286
Entity #39 | Chains: Cf
40S ribosomal protein S8 protein, length: 202 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 5 19732
95 % 2 5 17545
90 % 2 5 18277
70 % 48 91 446
50 % 58 183 258
40 % 58 187 262
30 % 58 187 275
Entity #4 | Chains: UD
Utp4 protein, length: 884 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 4 8 9749
95 % 4 8 10228
90 % 4 8 10146
70 % 4 8 9832
50 % 4 8 9155
40 % 4 8 8754
30 % 4 8 8158
Entity #40 | Chains: Cg
40S ribosomal protein s9-like protein protein, length: 190 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 12906
95 % 3 7 12938
90 % 3 7 12755
70 % 58 178 250
50 % 60 193 236
40 % 64 201 233
30 % 64 201 246
Entity #41 | Chains: Ch
40S ribosomal protein S13-like protein protein, length: 151 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13756
95 % 3 7 12881
90 % 3 7 12701
70 % 58 183 239
50 % 60 190 241
40 % 64 198 235
30 % 64 199 248
Entity #42 | Chains: Ci
40S ribosomal protein S14-like protein protein, length: 150 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 12905
95 % 3 7 12937
90 % 10 76 789
70 % 60 191 211
50 % 60 192 237
40 % 60 192 250
30 % 60 192 265
Entity #43 | Chains: Cj
40S ribosomal protein S16-like protein protein, length: 143 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13667
95 % 3 7 13326
90 % 3 7 13150
70 % 3 7 12498
50 % 60 185 250
40 % 64 193 249
30 % 64 194 261
Entity #44 | Chains: Ck
40S ribosomal protein S11-like protein protein, length: 161 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 5 20221
95 % 2 5 18399
90 % 2 5 18430
70 % 49 93 435
50 % 59 190 240
40 % 59 190 252
30 % 59 190 269
Entity #45 | Chains: Cm
40S ribosomal protein S22-like protein protein, length: 130 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13757
95 % 3 7 13526
90 % 3 7 13152
70 % 59 194 216
50 % 66 205 211
40 % 66 205 228
30 % 428 766 21
Entity #46 | Chains: Cn
40S ribosomal protein s23-like protein protein, length: 145 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13668
95 % 3 7 13327
90 % 3 7 13151
70 % 60 197 191
50 % 64 207 210
40 % 64 207 226
30 % 64 207 239
Entity #47 | Chains: Co
40S ribosomal protein S24 protein, length: 136 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 5 20158
95 % 2 5 18301
90 % 2 5 17972
70 % 2 5 16743
50 % 56 185 263
40 % 56 185 277
30 % 56 185 297
Entity #48 | Chains: Cp
40S ribosomal protein S28-like protein protein, length: 68 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13561
95 % 3 7 13112
90 % 3 7 13233
70 % 58 184 237
50 % 64 195 229
40 % 64 196 240
30 % 64 196 254
Entity #49 | Chains: CU
Faf1 protein, length: 311 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13079
95 % 3 7 13314
90 % 3 7 13263
70 % 3 7 12487
50 % 3 7 11392
40 % 3 7 10697
30 % 3 7 9865
Entity #5 | Chains: UF
Utp6 protein, length: 414 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13262
95 % 3 7 12765
90 % 3 7 13381
70 % 3 7 12707
50 % 3 7 11598
40 % 3 7 10895
30 % 3 7 10056
Entity #50 | Chains: C1
35S ribosomal RNA rna, length: 2352 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
Entity #51 | Chains: C2
U3 snoRNA rna, length: 230 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
Entity #52 | Chains: UV
U3 small nucleolar RNA-associated protein 22 protein, length: 1171 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 4 30561
95 % 1 4 25719
90 % 1 4 24891
70 % 1 4 22658
50 % 1 4 19982
40 % 1 4 18308
30 % 1 4 16407
Entity #53 | Chains: CV
Rrp7 protein, length: 322 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 4 29708
95 % 1 4 24521
90 % 1 4 23771
70 % 1 4 21652
50 % 1 4 19143
40 % 1 4 17572
30 % 1 4 15793
Entity #54 | Chains: CW
Ribosome biogenesis protein ENP2 protein, length: 668 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 4 28923
95 % 2 4 23458
90 % 2 4 22793
70 % 2 4 20819
50 % 2 4 18448
40 % 2 4 16965
30 % 2 4 15277
Entity #55 | Chains: UT
Utp20 protein, length: 2612 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 4 25863
95 % 2 4 26319
90 % 2 4 25462
70 % 2 4 23170
50 % 2 4 20372
40 % 2 4 18640
30 % 2 4 16699
Entity #56 | Chains: UH
Utp8 protein, length: 930 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 6 16053
95 % 3 6 17086
90 % 3 6 16795
70 % 3 6 15698
50 % 3 6 14173
40 % 3 6 13163
30 % 3 6 12007
Entity #57 | Chains: UE,UI
Utp5 protein, length: 410 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 6 6751
95 % 3 6 7410
90 % 3 6 7407
70 % 3 6 7230
50 % 3 6 6859
40 % 3 6 6259
30 % 3 6 6005
Entity #58 | Chains: US
Noc4 protein, length: 549 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 6 14307
95 % 3 6 16960
90 % 3 6 16796
70 % 3 6 15343
50 % 3 6 14095
40 % 3 6 12056
30 % 3 6 11040
Entity #59 | Chains: Cl
Rps18 protein, length: 156 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 6 16457
95 % 3 6 15605
90 % 3 6 14194
70 % 58 176 252
50 % 60 185 248
40 % 64 195 242
30 % 64 195 258
Entity #6 | Chains: UG
Utp7 protein, length: 558 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13411
95 % 3 7 12853
90 % 3 7 12660
70 % 3 7 12047
50 % 3 7 10999
40 % 3 9 8242
30 % 3 9 7692
Entity #60 | Chains: CX
Enp1 protein, length: 480 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 6 17225
95 % 3 6 14381
90 % 3 6 15323
70 % 3 6 14448
50 % 3 6 13080
40 % 3 6 12211
30 % 4 15 4987
Entity #61 | Chains: CY
U3 small nucleolar ribonucleoprotein protein lcp5-like protein protein, length: 381 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 3 34457
95 % 2 3 26500
90 % 2 3 25633
70 % 2 3 23881
50 % 2 3 20499
40 % 2 3 19176
30 % 2 3 16802
Entity #62 | Chains: CZ
Bfr2 protein, length: 609 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 4 28922
95 % 2 4 23457
90 % 2 4 22792
70 % 2 4 20818
50 % 2 4 18447
40 % 2 4 16964
30 % 2 4 15276
Entity #63 | Chains: UP
Utp16 protein, length: 364 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 6 15814
95 % 3 6 15397
90 % 3 6 16477
70 % 3 6 15426
50 % 3 6 13932
40 % 3 6 12962
30 % 3 6 11834
Entity #7 | Chains: UJ
UTP10 protein, length: 1802 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 8 12681
95 % 3 8 12530
90 % 3 8 11819
70 % 3 8 11759
50 % 3 8 10741
40 % 3 8 10106
30 % 3 8 9347
Entity #8 | Chains: UK
U3 small nucleolar RNA-associated protein 11 protein, length: 270 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13448
95 % 3 7 12909
90 % 3 7 12735
70 % 3 7 12112
50 % 3 7 11049
40 % 3 7 10389
30 % 3 7 9596
Entity #9 | Chains: UL
Utp12 protein, length: 962 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13216
95 % 3 7 12767
90 % 3 7 12594
70 % 3 7 11979
50 % 3 7 11683
40 % 3 11 7068
30 % 3 11 6611

Instructions

In the table for each entity, view a list of similar sequences by selecting the link associated with the percentage cutoff.



View more detailed documentation on the redundancy reduction and sequence clustering procedure used by RCSB PDB.

You can also use the structure comparison tool to compare any 2 given structures


ACTION - (A) Select for download / view details OR (B) Select two chains for comparison
Rank PDB ID Entity ID Chains Description Details Taxonomy EC Number
1 4V88 16 AO, CO 40S ribosomal protein S14-A 4932
2 4U4R 16 C4, c4 40S ribosomal protein S14-A 4932
3 4U3U 16 C4, c4 40S ribosomal protein S14-A 4932
4 5TBW 63 P, c4 40S ribosomal protein S14-B 4932
5 4U3M 16 C4, c4 40S ribosomal protein S14-A 4932
6 4U3N 16 C4, c4 40S ribosomal protein S14-A 4932
7 4U52 16 C4, c4 40S ribosomal protein S14-A 4932
8 4U4Q 16 C4, c4 40S ribosomal protein S14-A 4932
9 4U6F 16 C4, c4 40S ribosomal protein S14-A 4932
10 4U4U 16 C4, c4 40S ribosomal protein S14-A 4932
11 4U4Z 16 C4, c4 40S ribosomal protein S14-A 4932
12 4U4Y 16 C4, c4 40S ribosomal protein S14-A 4932
13 4U4N 16 C4, c4 40S ribosomal protein S14-A 4932
14 4U55 16 C4, c4 40S ribosomal protein S14-A 4932
15 5DAT 16 C4, c4 40S ribosomal protein S14-A 4932
16 5I4L 16 C4, c4 40S ribosomal protein S14-B 4932
17 4U51 16 C4, c4 40S ribosomal protein S14-A 4932
18 6HHQ 62 P, c4 40S ribosomal protein S14-B 4932
19 5OBM 60 C4, c4 40S ribosomal protein S14-B 4932
20 4U53 16 C4, c4 40S ribosomal protein S14-A 4932
21 5ON6 64 P, c4 40S ribosomal protein S14-B 4932
22 4U50 16 C4, c4 40S ribosomal protein S14-A 4932
23 5NDV 60 C4, c4 40S ribosomal protein S14-B 4932
24 5LYB 16 C4, c4 40S Ribosomal Protein S14 4932
25 4U56 16 C4, c4 40S ribosomal protein S14-A 4932
26 5TGA 16 C4, c4 40S ribosomal protein S14-B 4932
27 5MEI 63 P, c4 40S ribosomal protein S14-B 4932
28 5FCJ 16 C4, c4 40S ribosomal protein S14-A (UNK) residues correspond to residues that aren't well resolved, and for which side-chains could not be modeled. (UNK)s were substituted in the original sequence of the crystallized protein. Remaining misalignments result from differences in the distribution of (UNK)s between the two instances of the molecule in the structure. Here is the original sequence ot the crystallized protein : SNVVQARDNSQVFGVARIYASFNDTFVHVTDLSGKETIARVTGGMKVKADRDESSPYAAMLAAQDVAAKCKEVGITAVHV KIRATGGTRTKTPGPGGQAALRALARSGLRIGRIEDVTPVPSDSTRKKGGRRGRRL 4932
29 4U4O 16 C4, c4 40S ribosomal protein S14-A 4932
30 5DGV 16 C4, c4 40S ribosomal protein S14-A 4932
31 5DGE 16 C4, c4 40S ribosomal protein S14-A 4932
32 5NDW 9 C4, c4 40S ribosomal protein S14-B 4932
33 4BTS 21 AK, BK, CK, DK 40S RIBOSOMAL PROTEIN RPS14E 5911
34 5NDG 16 C4, c4 40S ribosomal protein S14-A 4932
35 5FCI 16 C4, c4 40S ribosomal protein S14-A (UNK) residues correspond to residues that aren't well resolved, and for which side-chains could not be modeled. (UNK)s were substituted in the original sequence of the crystallized protein. Remaining misalignments result from differences in the distribution of (UNK)s between the two instances of the molecule in the structure. Here is the original sequence ot the crystallized protein : SNVVQARDNSQVFGVARIYASFNDTFVHVTDLSGKETIARVTGGMKVKADRDESSPYAAMLAAQDVAAKCKEVGITAVHV KIRATGGTRTKTPGPGGQAALRALARSGLRIGRIEDVTPVPSDSTRKKGGRRGRRL 4932
36 5DC3 16 C4, c4 40S ribosomal protein S14-A 4932
37 5DGF 16 C4, c4 40S ribosomal protein S14-A 4932
38 4V5O 20 AK, BK RPS14E 5911
39 5TGM 16 C4, c4 40S ribosomal protein S14-A 4932
40 4V7R 9 AH, CH 40S ribosomal protein S14-A 4932
41 5VYC 15 O1, O2, O3, O4, O5, O6 40S ribosomal protein S14 9606
42 4KZZ 15 O 40S Ribosomal Protein S14 9986
43 4KZX 15 O 40S ribosomal protein S14 9986
44 4KZY 15 O 40S Ribosomal Protein S14 9986
45 6YAL 17 Q 40S ribosomal protein uS11 9986
46 6YAM 17 Q 40S ribosomal protein uS11 9986
47 6YAN 16 Q 40S ribosomal protein uS11 9986
48 6Y7C 14 O 40S ribosomal protein S14-A 4932
49 6UZ7 62 O 40S ribosomal protein S14 28985
50 6T83 17 Ob, p 40S ribosomal protein S14-A 4932
51 6T7T 19 SO 40S ribosomal protein S14-B 4932
52 6T7I 17 SO 40S ribosomal protein S14-A 4932
53 6T4Q 16 SO 40S ribosomal protein S14-B 4932
54 6SV4 33 Z, Zb, Zc 40S ribosomal protein S14-A 4932
55 6SNT 17 O 40S ribosomal protein S14-A 4932
56 6SGC 16 P1 uS11 9986
57 6S47 60 BP 40S ribosomal protein S14-A 4932
58 6RXT 39 Ci 40S ribosomal protein S14-like protein 209285
59 6RXU 42 Ci 40S ribosomal protein S14-like protein 209285
60 6RXV 42 Ci 40S ribosomal protein S14-like protein 209285
61 6RXX 24 Ci 40S ribosomal protein S14-like protein 209285
62 6RXY 38 Ci 40S ribosomal protein S14-like protein 209285
63 6RXZ 41 Ci 40S ribosomal protein S14-like protein 209285
64 6P5I 16 P uS11 9986
65 6P5J 16 P uS11 9986
66 6P5K 62 P uS11 9986
67 6P5N 62 P uS11 9986
68 6P4G 16 P uS11 9986
69 6P4H 17 P uS11 9986
70 6OM7 28 SO 40S ribosomal protein S14 9606
71 6OLZ 61 BO 40S ribosomal protein S14 9606
72 6OM0 28 SO 40S ribosomal protein S14 9606
73 6OLE 28 SO 40S ribosomal protein S14 9606
74 6OLF 28 SO 40S ribosomal protein S14 9606
75 6OLG 64 BO 40S ribosomal protein S14 9606
76 6OLI 28 SO 40S ribosomal protein S14 9606
77 6OKK 16 P 40S ribosomal protein S11 5833
78 6RBD 27 O 40S ribosomal protein S14-A 4932
79 6RBE 12 O 40S ribosomal protein S14-A 4932
80 6R7Q 13 MM uS11 9986
81 6R6G 36 MM 40S ribosomal protein S14 9986
82 6R6P 62 MM uS11 9986
83 6R5Q 66 MM uS11 9986
84 6QZP 75 SO 40S ribosomal protein S14 9606
85 6Q8Y 81 Z 40S ribosomal protein S14-B 4932
86 6I7O 33 Z, Zb 40S ribosomal protein S14-B 4932
87 6IP5 74 3L 40S ribosomal protein S14 9606
88 6IP6 73 3L 40S ribosomal protein S14 9606
89 6IP8 73 3L 40S ribosomal protein S14 9606
90 6MTB 65 OO 40S ribosomal protein S14 9986
91 6MTC 64 OO 40S ribosomal protein S14 9986
92 6MTD 66 OO uS11 9986
93 6MTE 65 OO uS11 9986
94 6HCQ 19 P2 uS11 9986
95 6HCJ 19 P2 uS11 9986
96 6HCM 16 P1 uS11 9986
97 6HCF 16 P1 uS11 9986
98 6GZ3 31 BO ribosomal protein uS11 9986
99 6GZ4 34 BO ribosomal protein uS11 9986
100 6GZ5 31 BO ribosomal protein uS11 9986
101 6GSM 18 O 40S ribosomal protein S14 28985
102 6GSN 38 O 40S ribosomal protein S14 28985
103 6GQV 62 AE 40S ribosomal protein S14-B 4932
104 6GQ1 62 AE 40S ribosomal protein S14-B 4932
105 6GQB 62 AE 40S ribosomal protein S14-B 4932
106 6D9J 64 PP uS11 9986
107 6D90 65 PP uS11 9986
108 6G5H 12 O 40S ribosomal protein S14 9606
109 6G5I 16 O 40S ribosomal protein S14 9606
110 6G4S 27 O 40S ribosomal protein S14 9606
111 6G4W 23 O 40S ribosomal protein S14 9606
112 6G51 13 O 40S ribosomal protein S14 9606
113 6G53 13 O 40S ribosomal protein S14 9606
114 6G18 23 O 40S ribosomal protein S14 9606
115 6FYX 18 O 40S ribosomal protein S14 28985
116 6FYY 18 O 40S ribosomal protein S14 28985
117 6FEC 38 j 40S ribosomal protein S14 9606
118 6FAI 25 O 40S ribosomal protein S14-A 4932
119 6EML 22 Z 40S ribosomal protein S14-A 4932
120 6EK0 75 SO 40S ribosomal protein S14 9606
121 6AZ1 15 O ribosomal protein S11 5661
122 5OQL 42 t 40S ribosomal protein S14-like protein 209285
123 5OPT 14 V 40S ribosomal protein S14, putative 5693
124 5WLC 40 NG rpS14_uS11 4932
125 5XYI 16 O Ribosomal protein S14 5722
126 5XXU 16 O Ribosomal protein uS11 5811
127 5OA3 19 O 40S ribosomal protein S14 9606
128 5WYJ 45 SP 40S ribosomal protein S14-A 4932
129 5WYK 41 SP 40S ribosomal protein S14-A 4932
130 5MC6 27 Z 40S ribosomal protein S14-A 4932
131 5M1J 22 O2 40S ribosomal protein S14-A 4932
132 5LZS 65 OO uS11 9986
133 5LZT 66 OO uS11 9986
134 5LZU 65 OO uS11 9986
135 5LZV 66 OO uS11 9986
136 5LZW 66 OO uS11 9986
137 5LZX 66 OO uS11 9986
138 5LZY 64 OO uS11 9986
139 5LZZ 66 OO uS11 9986
140 5T2A 63 AH uS11 5661
141 5T2C 80 AO 40S ribosomal protein S14 9606
142 5LL6 12 Z 40S ribosomal protein S14-A 4932
143 5LKS 74 SO 40S ribosomal protein S14 9606
144 5K0Y 32 j ribosomal protein uS11 9986
145 5JUO 64 LB uS11 (yeast S14) 4932
146 5JUP 64 LB uS11 (yeast S14) 4932
147 5JUS 64 LB uS11 (yeast S14) 4932
148 5JUT 64 LB uS11 (yeast S14) 4932
149 5JUU 64 LB uS11 (yeast S14) 4932
150 5JPQ 29 w uS11 209285
151 5IT7 62 O 40S ribosomal protein S14 28985
152 5IT9 15 O Ribosomal protein uS14 28985
153 5FLX 16 O 40S RIBOSOMAL PROTEIN S14 9986
154 3JAP 18 O uS11 28985
155 3JAQ 18 O uS11 28985
156 3JAM 16 O uS11 28985
157 3JAN 64 SO Ribosomal protein uS11 SEE REMARK 999 9986
158 3JAJ 65 SO Ribosomal protein uS11 SEE REMARK 999 9986
159 3JAG 66 OO uS11 9986
160 3JAH 66 OO uS11 9986
161 3JAI 66 OO uS11 9986
162 5A2Q 17 O RIBOSOMAL PROTEIN US11 9606
163 4UG0 76 SO 40S RIBOSOMAL PROTEIN S14 9606
164 5AJ0 64 BO 40S ribosomal protein S14 9606
165 4UER 21 K US11 4934
166 4D61 16 O 40S RIBOSOMAL PROTEIN S14 9986
167 4D5L 16 O 40S RIBOSOMAL PROTEIN US11 9986
168 3J81 16 O uS11 28985
169 3J80 12 O uS11 28985
170 3J7P 64 SO Ribosomal protein uS11 9823
171 3J7R 65 SO Ribosomal protein uS11 9823
172 4UJC 65 CO 40S RIBOSOMAL PROTEIN US11 9986
173 4UJD 65 CO 40S RIBOSOMAL PROTEIN ES11 9986
174 3J7A 16 P 40S ribosomal protein uS11 5833
175 3J77 60 14 40S ribosomal protein S14 4932
176 3J78 60 14 40S ribosomal protein S14 4932
177 3J6X 61 14 40S ribosomal protein S14 4932
178 3J6Y 61 14 40S ribosomal protein S14 4932
179 4UJE 19 BO 40S RIBOSOMAL PROTEIN S14 9986
180 4V92 17 BO US11 28985
181 4V7E 16 BO 40S ribosomal protein S11 4565
182 4V8Y 23 AO 40S RIBOSOMAL PROTEIN S14-A 4932
183 4V8Z 23 AO 40S RIBOSOMAL PROTEIN S14-A 4932
184 4V6W 5 AO 40S ribosomal protein S14 7227
185 4V6X 5 AO 40S ribosomal protein S14 9606
186 4V8M 16 AH 40S RIBOSOMAL PROTEIN S14 185431
187 3J0O 12 K Ribosomal protein S14 9986
188 3J0L 12 K Ribosomal protein S14 9986
189 4V6I 12 AK 40S ribosomal protein rpS14 (S11p) 4932
190 4V7H 10 AK 40S ribosomal protein S14(A) 5541
191 4V5Z 18 Ak 40S Ribosomal protein S14e 9612
192 4V4B 11 AK 40S ribosomal protein S14-A 4932