6RXV

Cryo-EM structure of the 90S pre-ribosome (Kre33-Noc4) from Chaetomium thermophilum, state B2


Sequence Similarity Clusters for the Entities in PDB 6RXV

Entity #1 | Chains: UA
Periodic tryptophan protein 2-like protein protein, length: 904 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 12509
95 % 3 7 12530
90 % 3 7 12364
70 % 3 7 11735
50 % 3 11 7099
40 % 3 11 6855
30 % 3 11 6426
Entity #10 | Chains: UM
Utp13 protein, length: 912 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13066
95 % 3 7 12499
90 % 3 7 12335
70 % 3 7 11713
50 % 3 7 10689
40 % 3 7 10077
30 % 3 7 9315
Entity #11 | Chains: UN
Utp14 protein, length: 938 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 12664
95 % 3 7 12816
90 % 3 7 12646
70 % 3 7 11988
50 % 3 7 11288
40 % 3 7 10316
30 % 3 7 9810
Entity #12 | Chains: UO
Utp15 protein, length: 557 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 12665
95 % 3 7 12817
90 % 3 7 12647
70 % 3 7 11989
50 % 3 7 10973
40 % 3 7 10317
30 % 3 9 7806
Entity #13 | Chains: UQ
Utp17 protein, length: 960 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 12514
95 % 3 7 13335
90 % 3 7 12369
70 % 3 7 11564
50 % 3 7 10560
40 % 3 7 9957
30 % 3 7 9206
Entity #14 | Chains: UR
Utp18 protein, length: 618 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 12425
95 % 3 7 12347
90 % 3 7 12181
70 % 3 7 11585
50 % 3 7 10576
40 % 3 7 9970
30 % 3 11 6568
Entity #15 | Chains: UU
Utp21 protein, length: 1049 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 12826
95 % 3 7 13091
90 % 3 7 12921
70 % 3 7 12242
50 % 3 7 11199
40 % 3 7 10552
30 % 3 7 9738
Entity #16 | Chains: UX
Utp24 protein, length: 193 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 8 10997
95 % 3 8 11387
90 % 3 8 11232
70 % 3 8 10770
50 % 3 12 6976
40 % 3 12 6744
30 % 3 12 6338
Entity #17 | Chains: UZ
Utp30 protein, length: 391 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 12666
95 % 3 7 13155
90 % 3 7 13017
70 % 3 7 12461
50 % 3 7 11230
40 % 3 7 10624
30 % 3 7 9528
Entity #18 | Chains: CA,CB
Nop1 protein, length: 313 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 4970
95 % 3 7 5924
90 % 3 7 5945
70 % 3 7 6010
50 % 3 11 3588
40 % 3 11 3572
30 % 3 11 3491
Entity #19 | Chains: CC
Nop56 protein, length: 523 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13065
95 % 3 7 12498
90 % 3 7 12334
70 % 3 7 11712
50 % 3 11 7133
40 % 3 15 5086
30 % 3 15 5014
Entity #2 | Chains: UB
Utp2 protein, length: 907 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13010
95 % 3 7 12393
90 % 3 7 12687
70 % 3 7 11625
50 % 3 7 10611
40 % 3 7 10347
30 % 3 7 9246
Entity #20 | Chains: CD
Nop58 protein, length: 582 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 12620
95 % 3 7 12721
90 % 3 7 12551
70 % 3 7 12477
50 % 3 7 10879
40 % 3 7 10747
30 % 3 7 9915
Entity #21 | Chains: CE,CF
Snu13 protein, length: 127 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 4915
95 % 3 7 5803
90 % 3 7 5911
70 % 3 7 5835
50 % 12 34 1328
40 % 13 35 1313
30 % 12 34 1401
Entity #22 | Chains: CG
Rrp9 protein, length: 630 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13461
95 % 3 7 13260
90 % 3 7 13086
70 % 3 7 12413
50 % 3 7 11357
40 % 3 7 10691
30 % 3 7 9865
Entity #23 | Chains: CH
RNA 3'-terminal phosphate cyclase-like protein protein, length: 411 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 12877
95 % 3 7 13187
90 % 3 7 13011
70 % 3 7 12326
50 % 3 7 11281
40 % 3 7 10621
30 % 3 7 9805
Entity #24 | Chains: CI
Bms1 protein, length: 1163 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 12621
95 % 3 7 12722
90 % 3 7 12552
70 % 3 7 11899
50 % 3 7 10880
40 % 3 11 7118
30 % 3 11 6685
Entity #25 | Chains: CJ
Imp3 protein, length: 183 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 8 10195
95 % 3 8 11130
90 % 3 8 10977
70 % 3 8 10533
50 % 3 12 6579
40 % 3 12 6385
30 % 3 12 6028
Entity #26 | Chains: CK
Imp4 protein, length: 297 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 8 11066
95 % 3 8 11940
90 % 3 8 11790
70 % 3 8 11234
50 % 3 11 7372
40 % 3 11 7114
30 % 3 11 6681
Entity #27 | Chains: CL
Mpp10 protein, length: 785 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 12622
95 % 3 7 12723
90 % 3 7 12553
70 % 3 7 11900
50 % 3 7 10881
40 % 3 7 10235
30 % 3 7 9460
Entity #28 | Chains: CM
Sof1 protein, length: 446 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13460
95 % 3 7 12877
90 % 3 7 13145
70 % 3 7 12040
50 % 3 7 11413
40 % 3 9 8273
30 % 3 9 7950
Entity #29 | Chains: CN,CO
Emg1 protein, length: 252 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 5378
95 % 3 7 5867
90 % 3 7 5852
70 % 8 17 2293
50 % 8 17 2339
40 % 8 17 2404
30 % 8 17 2383
Entity #3 | Chains: UC
Utp3 protein, length: 648 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13011
95 % 3 7 12395
90 % 3 7 12222
70 % 3 7 11628
50 % 3 7 10612
40 % 3 7 10009
30 % 3 7 9249
Entity #30 | Chains: CP
KRR1 small subunit processome component protein, length: 322 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 8 9190
95 % 3 8 9887
90 % 3 8 9364
70 % 3 11 7404
50 % 3 11 6453
40 % 3 11 6261
30 % 3 11 5922
Entity #31 | Chains: CQ
Pre-rRNA-processing protein PNO1 protein, length: 259 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 12667
95 % 3 7 12819
90 % 3 7 12649
70 % 3 7 11990
50 % 3 7 10974
40 % 3 7 10318
30 % 3 7 9529
Entity #32 | Chains: CR,CS
Kre33 protein, length: 1073 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 8 4331
95 % 3 8 4967
90 % 3 8 5038
70 % 3 8 5057
50 % 3 8 4962
40 % 3 8 4922
30 % 3 8 4731
Entity #33 | Chains: CT
Fcf2 protein, length: 203 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13124
95 % 3 7 12550
90 % 3 7 12382
70 % 3 7 11751
50 % 3 7 10732
40 % 3 7 10106
30 % 3 7 9341
Entity #34 | Chains: Ca
40S ribosomal protein S1 protein, length: 255 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 5 18787
95 % 3 5 18396
90 % 3 5 18029
70 % 41 81 490
50 % 46 137 360
40 % 48 144 352
30 % 48 144 370
Entity #35 | Chains: Cb
40S ribosomal protein S4 protein, length: 264 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 5 19532
95 % 2 5 18028
90 % 2 5 17319
70 % 45 163 264
50 % 47 173 264
40 % 47 177 271
30 % 47 182 277
Entity #36 | Chains: Cc
40S ribosomal protein s5-like protein protein, length: 212 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 12400
95 % 3 7 12294
90 % 3 7 12123
70 % 8 93 633
50 % 49 183 235
40 % 49 183 245
30 % 49 183 263
Entity #37 | Chains: Cd
40S ribosomal protein S6 protein, length: 239 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 5 18147
95 % 2 5 16685
90 % 2 5 17017
70 % 7 83 702
50 % 46 164 309
40 % 46 169 309
30 % 46 169 333
Entity #38 | Chains: Ce
40S ribosomal protein S7 protein, length: 203 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 12416
95 % 3 7 12332
90 % 3 7 12124
70 % 3 7 11565
50 % 46 170 287
40 % 46 170 303
30 % 48 173 305
Entity #39 | Chains: Cf
40S ribosomal protein S8 protein, length: 202 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 5 20037
95 % 2 5 18494
90 % 2 5 18121
70 % 40 83 477
50 % 47 172 267
40 % 47 176 274
30 % 47 176 298
Entity #4 | Chains: UD
Utp4 protein, length: 884 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 4 8 9289
95 % 4 8 9669
90 % 4 8 9836
70 % 4 8 9269
50 % 4 8 8630
40 % 4 8 8310
30 % 4 8 7727
Entity #40 | Chains: Cg
40S ribosomal protein s9-like protein protein, length: 190 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 12559
95 % 3 7 12619
90 % 3 7 12448
70 % 47 167 258
50 % 49 182 236
40 % 49 186 242
30 % 49 186 256
Entity #41 | Chains: Ch
40S ribosomal protein S13-like protein protein, length: 151 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13159
95 % 3 7 12705
90 % 3 7 12538
70 % 47 172 250
50 % 49 179 246
40 % 49 184 244
30 % 49 184 259
Entity #42 | Chains: Ci
40S ribosomal protein S14-like protein protein, length: 150 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 12760
95 % 3 7 12965
90 % 7 73 792
70 % 49 180 231
50 % 49 181 240
40 % 49 181 252
30 % 49 181 276
Entity #43 | Chains: Cj
40S ribosomal protein S16-like protein protein, length: 143 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13202
95 % 3 7 12790
90 % 3 7 12618
70 % 3 7 11961
50 % 49 174 260
40 % 49 178 262
30 % 49 179 281
Entity #44 | Chains: Ck
40S ribosomal protein S11-like protein protein, length: 161 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 5 19637
95 % 2 5 17805
90 % 2 5 17493
70 % 41 85 466
50 % 48 179 244
40 % 48 179 256
30 % 48 179 280
Entity #45 | Chains: Cm
40S ribosomal protein S22-like protein protein, length: 130 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13341
95 % 3 7 12618
90 % 3 7 12581
70 % 48 183 236
50 % 50 185 231
40 % 51 190 238
30 % 406 744 23
Entity #46 | Chains: Cn
40S ribosomal protein s23-like protein protein, length: 145 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13160
95 % 3 7 12522
90 % 3 7 12359
70 % 49 186 213
50 % 49 192 227
40 % 49 192 236
30 % 49 192 248
Entity #47 | Chains: Co
40S ribosomal protein S24 protein, length: 136 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 5 19757
95 % 2 5 17806
90 % 2 5 17701
70 % 40 85 474
50 % 45 174 273
40 % 45 174 288
30 % 45 174 311
Entity #48 | Chains: Cp
40S ribosomal protein S28-like protein protein, length: 68 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 12761
95 % 3 7 13079
90 % 3 7 12798
70 % 47 173 249
50 % 49 180 242
40 % 49 181 250
30 % 49 181 271
Entity #49 | Chains: CU
Faf1 protein, length: 311 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13438
95 % 3 7 13236
90 % 3 7 13061
70 % 3 7 12386
50 % 3 7 11330
40 % 3 7 10663
30 % 3 7 9842
Entity #5 | Chains: UF
Utp6 protein, length: 414 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 12882
95 % 3 7 13195
90 % 3 7 13018
70 % 3 7 12334
50 % 3 7 11289
40 % 3 7 10625
30 % 3 7 9811
Entity #50 | Chains: C1
35S ribosomal RNA rna, length: 2352 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
Entity #51 | Chains: C2
U3 snoRNA rna, length: 230 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
Entity #52 | Chains: UV
U3 small nucleolar RNA-associated protein 22 protein, length: 1171 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 4 29767
95 % 1 4 25038
90 % 1 4 24264
70 % 1 4 22158
50 % 1 4 19540
40 % 1 4 17906
30 % 1 4 16080
Entity #53 | Chains: CV
Rrp7 protein, length: 322 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 4 25190
95 % 1 4 25651
90 % 1 4 24813
70 % 1 4 22643
50 % 1 4 19932
40 % 1 4 18252
30 % 1 4 16374
Entity #54 | Chains: CW
Ribosome biogenesis protein ENP2 protein, length: 668 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 4 26538
95 % 2 4 20538
90 % 2 4 22208
70 % 2 4 20365
50 % 2 4 16524
40 % 2 4 16587
30 % 2 4 13869
Entity #55 | Chains: UT
Utp20 protein, length: 2612 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 4 26539
95 % 2 4 24630
90 % 2 4 20080
70 % 2 4 20366
50 % 2 4 16525
40 % 2 4 16588
30 % 2 4 14135
Entity #56 | Chains: UH
Utp8 protein, length: 930 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 6 16049
95 % 3 6 13931
90 % 3 6 15048
70 % 3 6 12992
50 % 3 6 11633
40 % 3 6 11989
30 % 3 6 10072
Entity #57 | Chains: UE,UI
Utp5 protein, length: 410 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 6 7023
95 % 3 6 7622
90 % 3 6 7599
70 % 3 6 7457
50 % 3 6 7018
40 % 3 6 6783
30 % 3 6 6366
Entity #58 | Chains: US
Noc4 protein, length: 549 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 6 17658
95 % 3 6 16509
90 % 3 6 16218
70 % 3 6 15162
50 % 3 6 13703
40 % 3 6 12761
30 % 3 6 11660
Entity #59 | Chains: Cl
Rps18 protein, length: 156 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 6 16788
95 % 3 6 15163
90 % 3 6 14903
70 % 47 165 260
50 % 49 174 258
40 % 49 180 254
30 % 49 180 278
Entity #6 | Chains: UG
Utp7 protein, length: 558 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13012
95 % 3 7 12396
90 % 3 7 12223
70 % 3 7 11629
50 % 3 7 10613
40 % 3 9 8136
30 % 3 9 7606
Entity #60 | Chains: CX
Enp1 protein, length: 480 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 6 16748
95 % 3 6 15100
90 % 3 6 14833
70 % 3 6 13970
50 % 3 6 12680
40 % 3 6 11863
30 % 3 14 5147
Entity #61 | Chains: CY
U3 small nucleolar ribonucleoprotein protein lcp5-like protein protein, length: 381 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 3 34332
95 % 2 3 26980
90 % 2 3 26027
70 % 2 3 23719
50 % 2 3 20821
40 % 2 3 19073
30 % 2 3 17101
Entity #62 | Chains: CZ
Bfr2 protein, length: 609 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 4 28157
95 % 2 4 22854
90 % 2 4 22216
70 % 2 4 20374
50 % 2 4 18053
40 % 2 4 16598
30 % 2 4 14974
Entity #63 | Chains: UP
Utp16 protein, length: 364 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 6 16787
95 % 3 6 15162
90 % 3 6 14902
70 % 3 6 14033
50 % 3 6 12720
40 % 3 6 11895
30 % 3 6 10903
Entity #7 | Chains: UJ
UTP10 protein, length: 1802 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 8 12274
95 % 3 8 12106
90 % 3 8 11942
70 % 3 8 11376
50 % 3 8 10404
40 % 3 8 9814
30 % 3 8 9093
Entity #8 | Chains: UK
U3 small nucleolar RNA-associated protein 11 protein, length: 270 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 12883
95 % 3 7 13196
90 % 3 7 13019
70 % 3 7 12335
50 % 3 7 11290
40 % 3 7 10626
30 % 3 7 9812
Entity #9 | Chains: UL
Utp12 protein, length: 962 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13456
95 % 3 7 13254
90 % 3 7 13080
70 % 3 7 12407
50 % 3 7 11352
40 % 3 11 6910
30 % 3 11 6479

Instructions

In the table for each entity, view a list of similar sequences by selecting the link associated with the percentage cutoff.



View more detailed documentation on the redundancy reduction and sequence clustering procedure used by RCSB PDB.

You can also use the structure comparison tool to compare any 2 given structures


ACTION - (A) Select for download / view details OR (B) Select two chains for comparison
Rank PDB ID Entity ID Chains Description Details Taxonomy EC Number
1 4V88 16 AO, CO 40S ribosomal protein S14-A 4932
2 4U4R 16 C4, c4 40S ribosomal protein S14-A 4932
3 4U3U 16 C4, c4 40S ribosomal protein S14-A 4932
4 5TBW 63 P, c4 40S ribosomal protein S14-B 4932
5 4U3M 16 C4, c4 40S ribosomal protein S14-A 4932
6 4U3N 16 C4, c4 40S ribosomal protein S14-A 4932
7 4U52 16 C4, c4 40S ribosomal protein S14-A 4932
8 4U4Q 16 C4, c4 40S ribosomal protein S14-A 4932
9 4U6F 16 C4, c4 40S ribosomal protein S14-A 4932
10 4U4U 16 C4, c4 40S ribosomal protein S14-A 4932
11 4U4Z 16 C4, c4 40S ribosomal protein S14-A 4932
12 4U4Y 16 C4, c4 40S ribosomal protein S14-A 4932
13 4U4N 16 C4, c4 40S ribosomal protein S14-A 4932
14 4U55 16 C4, c4 40S ribosomal protein S14-A 4932
15 5DAT 16 C4, c4 40S ribosomal protein S14-A 4932
16 5I4L 16 C4, c4 40S ribosomal protein S14-B 4932
17 4U51 16 C4, c4 40S ribosomal protein S14-A 4932
18 6HHQ 62 P, c4 40S ribosomal protein S14-B 4932
19 5OBM 60 C4, c4 40S ribosomal protein S14-B 4932
20 4U53 16 C4, c4 40S ribosomal protein S14-A 4932
21 5ON6 64 P, c4 40S ribosomal protein S14-B 4932
22 4U50 16 C4, c4 40S ribosomal protein S14-A 4932
23 5NDV 60 C4, c4 40S ribosomal protein S14-B 4932
24 5LYB 16 C4, c4 40S Ribosomal Protein S14 4932
25 4U56 16 C4, c4 40S ribosomal protein S14-A 4932
26 5TGA 16 C4, c4 40S ribosomal protein S14-B 4932
27 5MEI 63 P, c4 40S ribosomal protein S14-B 4932
28 5FCJ 16 C4, c4 40S ribosomal protein S14-A (UNK) residues correspond to residues that aren't well resolved, and for which side-chains could not be modeled. (UNK)s were substituted in the original sequence of the crystallized protein. Remaining misalignments result from differences in the distribution of (UNK)s between the two instances of the molecule in the structure. Here is the original sequence ot the crystallized protein : SNVVQARDNSQVFGVARIYASFNDTFVHVTDLSGKETIARVTGGMKVKADRDESSPYAAMLAAQDVAAKCKEVGITAVHV KIRATGGTRTKTPGPGGQAALRALARSGLRIGRIEDVTPVPSDSTRKKGGRRGRRL 4932
29 4U4O 16 C4, c4 40S ribosomal protein S14-A 4932
30 5DGV 16 C4, c4 40S ribosomal protein S14-A 4932
31 5DGE 16 C4, c4 40S ribosomal protein S14-A 4932
32 5NDW 9 C4, c4 40S ribosomal protein S14-B 4932
33 4BTS 21 AK, BK, CK, DK 40S RIBOSOMAL PROTEIN RPS14E 5911
34 5NDG 16 C4, c4 40S ribosomal protein S14-A 4932
35 5FCI 16 C4, c4 40S ribosomal protein S14-A (UNK) residues correspond to residues that aren't well resolved, and for which side-chains could not be modeled. (UNK)s were substituted in the original sequence of the crystallized protein. Remaining misalignments result from differences in the distribution of (UNK)s between the two instances of the molecule in the structure. Here is the original sequence ot the crystallized protein : SNVVQARDNSQVFGVARIYASFNDTFVHVTDLSGKETIARVTGGMKVKADRDESSPYAAMLAAQDVAAKCKEVGITAVHV KIRATGGTRTKTPGPGGQAALRALARSGLRIGRIEDVTPVPSDSTRKKGGRRGRRL 4932
36 5DC3 16 C4, c4 40S ribosomal protein S14-A 4932
37 5DGF 16 C4, c4 40S ribosomal protein S14-A 4932
38 4V5O 20 AK, BK RPS14E 5911
39 5TGM 16 C4, c4 40S ribosomal protein S14-A 4932
40 4V7R 9 AH, CH 40S ribosomal protein S14-A 4932
41 5VYC 15 O1, O2, O3, O4, O5, O6 40S ribosomal protein S14 9606
42 4KZZ 15 O 40S Ribosomal Protein S14 9986
43 4KZX 15 O 40S ribosomal protein S14 9986
44 4KZY 15 O 40S Ribosomal Protein S14 9986
45 6SGC 16 P1 uS11 9986
46 6S47 60 BP 40S ribosomal protein S14-A 4932
47 6RXT 39 Ci 40S ribosomal protein S14-like protein 209285
48 6RXU 42 Ci 40S ribosomal protein S14-like protein 209285
49 6RXV 42 Ci 40S ribosomal protein S14-like protein 209285
50 6RXX 24 Ci 40S ribosomal protein S14-like protein 209285
51 6RXY 38 Ci 40S ribosomal protein S14-like protein 209285
52 6RXZ 41 Ci 40S ribosomal protein S14-like protein 209285
53 6P5I 16 P uS11 9986
54 6P5J 16 P uS11 9986
55 6P5K 62 P uS11 9986
56 6P5N 62 P uS11 9986
57 6P4G 16 P uS11 9986
58 6P4H 17 P uS11 9986
59 6OM7 28 SO 40S ribosomal protein S14 9606
60 6OLZ 61 BO 40S ribosomal protein S14 9606
61 6OM0 28 SO 40S ribosomal protein S14 9606
62 6OLE 28 SO 40S ribosomal protein S14 9606
63 6OLF 28 SO 40S ribosomal protein S14 9606
64 6OLG 64 BO 40S ribosomal protein S14 9606
65 6OLI 28 SO 40S ribosomal protein S14 9606
66 6OKK 16 P 40S ribosomal protein S11 5833
67 6RBD 27 O 40S ribosomal protein S14-A 4932
68 6RBE 12 O 40S ribosomal protein S14-A 4932
69 6R7Q 13 MM uS11 9986
70 6R6G 36 MM 40S ribosomal protein S14 9986
71 6R6P 62 MM uS11 9986
72 6R5Q 66 MM uS11 9986
73 6QZP 75 SO 40S ribosomal protein S14 9606
74 6Q8Y 81 Z 40S ribosomal protein S14-B 4932
75 6I7O 33 Z, Zb 40S ribosomal protein S14-B 4932
76 6IP5 74 3L 40S ribosomal protein S14 9606
77 6IP6 73 3L 40S ribosomal protein S14 9606
78 6IP8 73 3L 40S ribosomal protein S14 9606
79 6MTB 65 OO 40S ribosomal protein S14 9986
80 6MTC 64 OO 40S ribosomal protein S14 9986
81 6MTD 66 OO uS11 9986
82 6MTE 65 OO uS11 9986
83 6HCQ 19 P2 uS11 9986
84 6HCJ 19 P2 uS11 9986
85 6HCM 16 P1 uS11 9986
86 6HCF 16 P1 uS11 9986
87 6GZ3 31 BO ribosomal protein uS11 9986
88 6GZ4 34 BO ribosomal protein uS11 9986
89 6GZ5 31 BO ribosomal protein uS11 9986
90 6GSM 18 O 40S ribosomal protein S14 28985
91 6GSN 38 O 40S ribosomal protein S14 28985
92 6GQV 62 AE 40S ribosomal protein S14-B 4932
93 6GQ1 62 AE 40S ribosomal protein S14-B 4932
94 6GQB 62 AE 40S ribosomal protein S14-B 4932
95 6D9J 64 PP uS11 9986
96 6D90 65 PP uS11 9986
97 6G5H 12 O 40S ribosomal protein S14 9606
98 6G5I 16 O 40S ribosomal protein S14 9606
99 6G4S 27 O 40S ribosomal protein S14 9606
100 6G4W 23 O 40S ribosomal protein S14 9606
101 6G51 13 O 40S ribosomal protein S14 9606
102 6G53 13 O 40S ribosomal protein S14 9606
103 6G18 23 O 40S ribosomal protein S14 9606
104 6FYX 18 O 40S ribosomal protein S14 28985
105 6FYY 18 O 40S ribosomal protein S14 28985
106 6FEC 38 j 40S ribosomal protein S14 9606
107 6FAI 25 O 40S ribosomal protein S14-A 4932
108 6EML 22 Z 40S ribosomal protein S14-A 4932
109 6EK0 75 SO 40S ribosomal protein S14 9606
110 6AZ1 15 O ribosomal protein S11 5661
111 5OQL 42 t 40S ribosomal protein S14-like protein 209285
112 5OPT 14 V 40S ribosomal protein S14, putative 5693
113 5WLC 40 NG rpS14_uS11 4932
114 5XYI 16 O Ribosomal protein S14 5722
115 5XXU 16 O Ribosomal protein uS11 5811
116 5OA3 19 O 40S ribosomal protein S14 9606
117 5WYJ 45 SP 40S ribosomal protein S14-A 4932
118 5WYK 41 SP 40S ribosomal protein S14-A 4932
119 5MC6 27 Z 40S ribosomal protein S14-A 4932
120 5M1J 22 O2 40S ribosomal protein S14-A 4932
121 5LZS 65 OO uS11 9986
122 5LZT 66 OO uS11 9986
123 5LZU 65 OO uS11 9986
124 5LZV 66 OO uS11 9986
125 5LZW 66 OO uS11 9986
126 5LZX 66 OO uS11 9986
127 5LZY 64 OO uS11 9986
128 5LZZ 66 OO uS11 9986
129 5T2A 63 AH uS11 5661
130 5T2C 80 AO 40S ribosomal protein S14 9606
131 5LL6 12 Z 40S ribosomal protein S14-A 4932
132 5LKS 74 SO 40S ribosomal protein S14 9606
133 5K0Y 32 j ribosomal protein uS11 9986
134 5JUO 64 LB uS11 (yeast S14) 4932
135 5JUP 64 LB uS11 (yeast S14) 4932
136 5JUS 64 LB uS11 (yeast S14) 4932
137 5JUT 64 LB uS11 (yeast S14) 4932
138 5JUU 64 LB uS11 (yeast S14) 4932
139 5JPQ 29 w uS11 209285
140 5IT7 62 O 40S ribosomal protein S14 28985
141 5IT9 15 O Ribosomal protein uS14 28985
142 5FLX 16 O 40S RIBOSOMAL PROTEIN S14 9986
143 3JAP 18 O uS11 28985
144 3JAQ 18 O uS11 28985
145 3JAM 16 O uS11 28985
146 3JAN 64 SO Ribosomal protein uS11 SEE REMARK 999 9986
147 3JAJ 65 SO Ribosomal protein uS11 SEE REMARK 999 9986
148 3JAG 66 OO uS11 9986
149 3JAH 66 OO uS11 9986
150 3JAI 66 OO uS11 9986
151 5A2Q 17 O RIBOSOMAL PROTEIN US11 9606
152 4UG0 76 SO 40S RIBOSOMAL PROTEIN S14 9606
153 5AJ0 64 BO 40S ribosomal protein S14 9606
154 4UER 21 K US11 4934
155 4D61 16 O 40S RIBOSOMAL PROTEIN S14 9986
156 4D5L 16 O 40S RIBOSOMAL PROTEIN US11 9986
157 3J81 16 O uS11 28985
158 3J80 12 O uS11 28985
159 3J7P 64 SO Ribosomal protein uS11 9823
160 3J7R 65 SO Ribosomal protein uS11 9823
161 4UJC 65 CO 40S RIBOSOMAL PROTEIN US11 9986
162 4UJD 65 CO 40S RIBOSOMAL PROTEIN ES11 9986
163 3J7A 16 P 40S ribosomal protein uS11 5833
164 3J77 60 14 40S ribosomal protein S14 4932
165 3J78 60 14 40S ribosomal protein S14 4932
166 3J6X 61 14 40S ribosomal protein S14 4932
167 3J6Y 61 14 40S ribosomal protein S14 4932
168 4UJE 19 BO 40S RIBOSOMAL PROTEIN S14 9986
169 4V92 17 BO US11 28985
170 4V7E 16 BO 40S ribosomal protein S11 4565
171 4V8Y 23 AO 40S RIBOSOMAL PROTEIN S14-A 4932
172 4V8Z 23 AO 40S RIBOSOMAL PROTEIN S14-A 4932
173 4V6W 5 AO 40S ribosomal protein S14 7227
174 4V6X 5 AO 40S ribosomal protein S14 9606
175 4V8M 16 AH 40S RIBOSOMAL PROTEIN S14 185431
176 3J0O 12 K Ribosomal protein S14 9986
177 3J0L 12 K Ribosomal protein S14 9986
178 4V6I 12 AK 40S ribosomal protein rpS14 (S11p) 4932
179 4V7H 10 AK 40S ribosomal protein S14(A) 5541
180 4V5Z 18 Ak 40S Ribosomal protein S14e 9612
181 4V4B 11 AK 40S ribosomal protein S14-A 4932