6RXV

Cryo-EM structure of the 90S pre-ribosome (Kre33-Noc4) from Chaetomium thermophilum, state B2


Sequence Similarity Clusters for the Entities in PDB 6RXV

Entity #1 | Chains: UA
Periodic tryptophan protein 2-like protein protein, length: 904 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13487
95 % 3 7 13830
90 % 3 7 13638
70 % 3 7 12925
50 % 3 11 7683
40 % 3 11 7383
30 % 3 11 6945
Entity #10 | Chains: UM
Utp13 protein, length: 912 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13931
95 % 3 7 13558
90 % 3 7 13360
70 % 3 7 12662
50 % 3 7 11575
40 % 3 7 10869
30 % 3 7 10040
Entity #11 | Chains: UN
Utp14 protein, length: 938 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13840
95 % 3 7 13205
90 % 3 7 13002
70 % 3 7 12112
50 % 3 7 11278
40 % 3 7 10390
30 % 3 7 9792
Entity #12 | Chains: UO
Utp15 protein, length: 557 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13688
95 % 3 7 13058
90 % 3 7 12740
70 % 3 7 12243
50 % 3 7 11062
40 % 3 7 10492
30 % 3 9 8041
Entity #13 | Chains: UQ
Utp17 protein, length: 960 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13687
95 % 3 7 13057
90 % 3 7 12877
70 % 3 7 12242
50 % 3 7 11171
40 % 3 7 10491
30 % 3 7 9702
Entity #14 | Chains: UR
Utp18 protein, length: 618 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13140
95 % 3 7 13081
90 % 3 7 12901
70 % 3 7 12266
50 % 3 7 11196
40 % 3 7 10508
30 % 3 11 6770
Entity #15 | Chains: UU
Utp21 protein, length: 1049 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13436
95 % 3 7 13720
90 % 3 7 13529
70 % 3 7 12811
50 % 3 7 11716
40 % 3 7 11012
30 % 3 7 10170
Entity #16 | Chains: UX
Utp24 protein, length: 193 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 8 12615
95 % 3 8 11944
90 % 3 8 11803
70 % 3 8 11270
50 % 3 12 6695
40 % 3 12 6472
30 % 3 12 6143
Entity #17 | Chains: UZ
Utp30 protein, length: 391 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13932
95 % 3 7 13559
90 % 3 7 13361
70 % 3 7 12663
50 % 3 7 11576
40 % 3 7 10870
30 % 3 7 10041
Entity #18 | Chains: CA,CB
Nop1 protein, length: 313 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 5132
95 % 3 7 6131
90 % 3 7 6027
70 % 3 7 5936
50 % 3 11 3645
40 % 3 11 3610
30 % 3 11 3529
Entity #19 | Chains: CC
Nop56 protein, length: 523 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 14148
95 % 3 7 13945
90 % 3 7 13758
70 % 3 7 13039
50 % 3 11 7466
40 % 3 14 5886
30 % 3 14 5414
Entity #2 | Chains: UB
Utp2 protein, length: 907 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13924
95 % 3 7 13549
90 % 3 7 13346
70 % 3 7 12652
50 % 3 7 11561
40 % 3 7 10857
30 % 3 7 10028
Entity #20 | Chains: CD
Nop58 protein, length: 582 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13972
95 % 3 7 13633
90 % 3 7 13442
70 % 3 7 12735
50 % 3 7 11080
40 % 3 7 10935
30 % 3 7 10102
Entity #21 | Chains: CE,CF
Snu13 protein, length: 127 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 5360
95 % 3 7 6442
90 % 3 7 6446
70 % 3 7 6331
50 % 12 34 1418
40 % 13 35 1406
30 % 12 34 1495
Entity #22 | Chains: CG
Rrp9 protein, length: 630 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13963
95 % 3 7 13501
90 % 3 7 13297
70 % 3 7 12343
50 % 3 7 11514
40 % 3 7 10805
30 % 3 7 9982
Entity #23 | Chains: CH
RNA 3'-terminal phosphate cyclase-like protein protein, length: 411 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13888
95 % 3 7 13502
90 % 3 7 13333
70 % 3 7 12603
50 % 3 7 11515
40 % 3 7 10806
30 % 3 7 9983
Entity #24 | Chains: CI
Bms1 protein, length: 1163 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13889
95 % 3 7 13503
90 % 3 7 13298
70 % 3 7 12604
50 % 3 7 11516
40 % 3 11 7415
30 % 3 11 6969
Entity #25 | Chains: CJ
Imp3 protein, length: 183 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 8 10561
95 % 3 8 12839
90 % 3 8 11211
70 % 3 8 10761
50 % 3 12 7285
40 % 3 12 7010
30 % 3 12 6593
Entity #26 | Chains: CK
Imp4 protein, length: 297 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 8 11646
95 % 3 8 12513
90 % 3 8 12333
70 % 3 8 11749
50 % 3 11 7712
40 % 3 11 7412
30 % 3 11 6967
Entity #27 | Chains: CL
Mpp10 protein, length: 785 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13418
95 % 3 7 13669
90 % 3 7 13480
70 % 3 7 12765
50 % 3 7 11668
40 % 3 7 10964
30 % 3 7 10129
Entity #28 | Chains: CM
Sof1 protein, length: 446 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13890
95 % 3 7 13504
90 % 3 7 13299
70 % 3 7 12605
50 % 3 7 11517
40 % 3 9 8634
30 % 3 9 8098
Entity #29 | Chains: CN,CO
Emg1 protein, length: 252 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 5560
95 % 3 7 6474
90 % 3 7 6485
70 % 8 17 2487
50 % 8 17 2483
40 % 8 17 2483
30 % 8 17 2487
Entity #3 | Chains: UC
Utp3 protein, length: 648 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 14123
95 % 3 7 13903
90 % 3 7 13714
70 % 3 7 13000
50 % 3 7 11879
40 % 3 7 11154
30 % 3 7 10293
Entity #30 | Chains: CP
KRR1 small subunit processome component protein, length: 322 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 8 9122
95 % 3 8 9672
90 % 3 8 9580
70 % 3 11 7097
50 % 3 11 6488
40 % 3 11 6281
30 % 3 11 5989
Entity #31 | Chains: CQ
Pre-rRNA-processing protein PNO1 protein, length: 259 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13770
95 % 3 7 13227
90 % 3 7 13019
70 % 3 7 12373
50 % 3 7 11304
40 % 3 7 10603
30 % 3 7 9807
Entity #32 | Chains: CR,CS
Kre33 protein, length: 1073 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 8 4672
95 % 3 8 5362
90 % 3 8 5389
70 % 3 8 5331
50 % 3 8 5165
40 % 3 8 5193
30 % 3 8 4987
Entity #33 | Chains: CT
Fcf2 protein, length: 203 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13043
95 % 3 7 12983
90 % 3 7 12804
70 % 3 7 12169
50 % 3 7 11026
40 % 3 7 10355
30 % 3 7 9604
Entity #34 | Chains: Ca
40S ribosomal protein S1 protein, length: 255 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 5 18635
95 % 3 5 19009
90 % 3 5 17779
70 % 51 91 463
50 % 53 97 468
40 % 65 161 337
30 % 65 161 355
Entity #35 | Chains: Cb
40S ribosomal protein S4 protein, length: 264 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 5 21026
95 % 2 5 17982
90 % 2 5 18964
70 % 63 181 260
50 % 65 191 252
40 % 65 195 258
30 % 69 204 254
Entity #36 | Chains: Cc
40S ribosomal protein s5-like protein protein, length: 212 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13384
95 % 3 7 13228
90 % 3 7 13020
70 % 16 101 614
50 % 67 201 232
40 % 67 201 244
30 % 67 201 258
Entity #37 | Chains: Cd
40S ribosomal protein S6 protein, length: 239 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 5 20787
95 % 2 5 18945
90 % 2 5 18583
70 % 15 91 691
50 % 64 182 294
40 % 64 187 288
30 % 64 187 307
Entity #38 | Chains: Ce
40S ribosomal protein S7 protein, length: 203 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13801
95 % 3 7 13082
90 % 3 7 13092
70 % 3 7 12436
50 % 64 188 270
40 % 64 188 284
30 % 66 191 283
Entity #39 | Chains: Cf
40S ribosomal protein S8 protein, length: 202 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 5 20268
95 % 2 5 17872
90 % 2 5 18582
70 % 50 93 458
50 % 65 190 256
40 % 65 194 260
30 % 65 194 275
Entity #4 | Chains: UD
Utp4 protein, length: 884 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 4 8 9997
95 % 4 8 10444
90 % 4 8 10358
70 % 4 8 10034
50 % 4 8 9352
40 % 4 8 8922
30 % 4 8 8337
Entity #40 | Chains: Cg
40S ribosomal protein s9-like protein protein, length: 190 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13722
95 % 3 7 13518
90 % 3 7 12929
70 % 65 185 250
50 % 67 200 233
40 % 71 208 233
30 % 71 208 246
Entity #41 | Chains: Ch
40S ribosomal protein S13-like protein protein, length: 151 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13800
95 % 3 7 13296
90 % 3 7 13091
70 % 65 194 240
50 % 67 197 243
40 % 71 205 237
30 % 71 206 249
Entity #42 | Chains: Ci
40S ribosomal protein S14-like protein protein, length: 150 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13190
95 % 3 7 13204
90 % 15 81 762
70 % 67 198 224
50 % 67 199 237
40 % 67 199 247
30 % 67 199 260
Entity #43 | Chains: Cj
40S ribosomal protein S16-like protein protein, length: 143 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13416
95 % 3 7 13398
90 % 3 7 13183
70 % 3 7 12717
50 % 65 190 251
40 % 69 198 251
30 % 69 199 262
Entity #44 | Chains: Ck
40S ribosomal protein S11-like protein protein, length: 161 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 5 20620
95 % 2 5 18650
90 % 2 5 18496
70 % 51 95 448
50 % 66 197 242
40 % 66 197 253
30 % 66 197 266
Entity #45 | Chains: Cm
40S ribosomal protein S22-like protein protein, length: 130 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13802
95 % 3 7 13297
90 % 3 7 13093
70 % 66 201 232
50 % 73 212 221
40 % 74 214 227
30 % 74 214 238
Entity #46 | Chains: Cn
40S ribosomal protein s23-like protein protein, length: 145 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13360
95 % 3 7 13583
90 % 3 7 13386
70 % 67 204 214
50 % 71 214 219
40 % 71 214 228
30 % 71 214 239
Entity #47 | Chains: Co
40S ribosomal protein S24 protein, length: 136 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 5 18981
95 % 2 5 18010
90 % 2 5 18548
70 % 50 95 451
50 % 63 192 263
40 % 63 192 276
30 % 63 192 291
Entity #48 | Chains: Cp
40S ribosomal protein S28-like protein protein, length: 68 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13693
95 % 3 7 13091
90 % 3 7 13325
70 % 65 191 246
50 % 71 202 229
40 % 71 203 240
30 % 71 203 253
Entity #49 | Chains: CU
Faf1 protein, length: 311 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 14016
95 % 3 7 13709
90 % 3 7 13033
70 % 3 7 12391
50 % 3 7 11314
40 % 3 7 10616
30 % 3 7 9890
Entity #5 | Chains: UF
Utp6 protein, length: 414 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13141
95 % 3 7 13087
90 % 3 7 12902
70 % 3 7 12261
50 % 3 7 11190
40 % 3 7 10865
30 % 3 7 9715
Entity #50 | Chains: C1
35S ribosomal RNA rna, length: 2352 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
Entity #51 | Chains: C2
U3 snoRNA rna, length: 230 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
Entity #52 | Chains: UV
U3 small nucleolar RNA-associated protein 22 protein, length: 1171 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 4 31496
95 % 1 4 22891
90 % 1 4 22201
70 % 1 4 23566
50 % 1 4 20700
40 % 1 4 18795
30 % 1 4 16963
Entity #53 | Chains: CV
Rrp7 protein, length: 322 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 4 26372
95 % 1 4 26820
90 % 1 4 25928
70 % 1 4 23567
50 % 1 4 20701
40 % 1 4 18928
30 % 1 4 16964
Entity #54 | Chains: CW
Ribosome biogenesis protein ENP2 protein, length: 668 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 4 29533
95 % 2 4 23891
90 % 2 4 23164
70 % 2 4 21208
50 % 2 4 18756
40 % 2 4 17220
30 % 2 4 15532
Entity #55 | Chains: UT
Utp20 protein, length: 2612 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 4 31495
95 % 2 4 26818
90 % 2 4 25926
70 % 2 4 23565
50 % 2 4 20699
40 % 2 4 18926
30 % 2 4 16962
Entity #56 | Chains: UH
Utp8 protein, length: 930 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 6 17707
95 % 3 6 14923
90 % 3 6 15785
70 % 3 6 14829
50 % 3 6 12652
40 % 3 6 11812
30 % 3 6 10875
Entity #57 | Chains: UE,UI
Utp5 protein, length: 410 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 6 6213
95 % 3 6 8024
90 % 3 6 7986
70 % 3 6 7770
50 % 3 6 7307
40 % 3 6 7033
30 % 3 6 6616
Entity #58 | Chains: US
Noc4 protein, length: 549 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 6 15657
95 % 3 6 16271
90 % 3 6 15998
70 % 3 6 15779
50 % 3 6 13571
40 % 3 6 13228
30 % 3 6 12085
Entity #59 | Chains: Cl
Rps18 protein, length: 156 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 6 15656
95 % 3 6 16270
90 % 3 6 15997
70 % 65 183 254
50 % 67 192 248
40 % 71 202 241
30 % 71 202 255
Entity #6 | Chains: UG
Utp7 protein, length: 558 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 14144
95 % 3 7 13940
90 % 3 7 13753
70 % 3 7 12767
50 % 3 7 11670
40 % 3 9 8388
30 % 3 9 7851
Entity #60 | Chains: CX
Enp1 protein, length: 480 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 6 17640
95 % 3 6 15916
90 % 3 6 15666
70 % 3 6 14713
50 % 3 6 13303
40 % 3 6 12386
30 % 4 15 5228
Entity #61 | Chains: CY
U3 small nucleolar ribonucleoprotein protein lcp5-like protein protein, length: 381 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 3 36372
95 % 2 3 28708
90 % 2 3 27642
70 % 2 3 25019
50 % 2 3 21934
40 % 2 3 20058
30 % 2 3 17966
Entity #62 | Chains: CZ
Bfr2 protein, length: 609 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 4 25834
95 % 2 4 26120
90 % 2 4 25287
70 % 2 4 23011
50 % 2 4 20264
40 % 2 4 18540
30 % 2 4 16644
Entity #63 | Chains: UP
Utp16 protein, length: 364 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 6 16196
95 % 3 6 15741
90 % 3 6 15401
70 % 3 6 15679
50 % 3 6 14144
40 % 3 6 13145
30 % 3 6 12013
Entity #7 | Chains: UJ
UTP10 protein, length: 1802 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 8 11947
95 % 3 8 11185
90 % 3 8 11077
70 % 3 8 10647
50 % 3 8 9860
40 % 3 8 9399
30 % 3 8 8733
Entity #8 | Chains: UK
U3 small nucleolar RNA-associated protein 11 protein, length: 270 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13744
95 % 3 7 13163
90 % 3 7 12966
70 % 3 7 12331
50 % 3 7 11252
40 % 3 7 10569
30 % 3 7 9776
Entity #9 | Chains: UL
Utp12 protein, length: 962 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13743
95 % 3 7 13162
90 % 3 7 12965
70 % 3 7 12330
50 % 3 7 11901
40 % 3 11 7203
30 % 3 11 6771

Instructions

In the table for each entity, view a list of similar sequences by selecting the link associated with the percentage cutoff.



View more detailed documentation on the redundancy reduction and sequence clustering procedure used by RCSB PDB.

You can also use the structure comparison tool to compare any 2 given structures


ACTION - (A) Select for download / view details OR (B) Select two chains for comparison
Rank PDB ID Entity ID Chains Description Details Taxonomy EC Number
1 4V88 16 AO, CO 40S ribosomal protein S14-A 4932
2 4U4R 16 C4, c4 40S ribosomal protein S14-A 4932
3 4U3U 16 C4, c4 40S ribosomal protein S14-A 4932
4 5TBW 63 P, c4 40S ribosomal protein S14-B 4932
5 4U3M 16 C4, c4 40S ribosomal protein S14-A 4932
6 4U3N 16 C4, c4 40S ribosomal protein S14-A 4932
7 4U52 16 C4, c4 40S ribosomal protein S14-A 4932
8 4U4Q 16 C4, c4 40S ribosomal protein S14-A 4932
9 4U6F 16 C4, c4 40S ribosomal protein S14-A 4932
10 4U4U 16 C4, c4 40S ribosomal protein S14-A 4932
11 4U4Z 16 C4, c4 40S ribosomal protein S14-A 4932
12 4U4Y 16 C4, c4 40S ribosomal protein S14-A 4932
13 4U4N 16 C4, c4 40S ribosomal protein S14-A 4932
14 4U55 16 C4, c4 40S ribosomal protein S14-A 4932
15 5DAT 16 C4, c4 40S ribosomal protein S14-A 4932
16 5I4L 16 C4, c4 40S ribosomal protein S14-B 4932
17 4U51 16 C4, c4 40S ribosomal protein S14-A 4932
18 6HHQ 62 P, c4 40S ribosomal protein S14-B 4932
19 5OBM 60 C4, c4 40S ribosomal protein S14-B 4932
20 4U53 16 C4, c4 40S ribosomal protein S14-A 4932
21 5ON6 64 P, c4 40S ribosomal protein S14-B 4932
22 4U50 16 C4, c4 40S ribosomal protein S14-A 4932
23 5NDV 60 C4, c4 40S ribosomal protein S14-B 4932
24 5LYB 16 C4, c4 40S Ribosomal Protein S14 4932
25 4U56 16 C4, c4 40S ribosomal protein S14-A 4932
26 5TGA 16 C4, c4 40S ribosomal protein S14-B 4932
27 5MEI 63 P, c4 40S ribosomal protein S14-B 4932
28 5FCJ 16 C4, c4 40S ribosomal protein S14-A (UNK) residues correspond to residues that aren't well resolved, and for which side-chains could not be modeled. (UNK)s were substituted in the original sequence of the crystallized protein. Remaining misalignments result from differences in the distribution of (UNK)s between the two instances of the molecule in the structure. Here is the original sequence ot the crystallized protein : SNVVQARDNSQVFGVARIYASFNDTFVHVTDLSGKETIARVTGGMKVKADRDESSPYAAMLAAQDVAAKCKEVGITAVHV KIRATGGTRTKTPGPGGQAALRALARSGLRIGRIEDVTPVPSDSTRKKGGRRGRRL 4932
29 4U4O 16 C4, c4 40S ribosomal protein S14-A 4932
30 5DGV 16 C4, c4 40S ribosomal protein S14-A 4932
31 5DGE 16 C4, c4 40S ribosomal protein S14-A 4932
32 5NDW 9 C4, c4 40S ribosomal protein S14-B 4932
33 4BTS 21 AK, BK, CK, DK 40S RIBOSOMAL PROTEIN RPS14E 5911
34 5NDG 16 C4, c4 40S ribosomal protein S14-A 4932
35 5FCI 16 C4, c4 40S ribosomal protein S14-A (UNK) residues correspond to residues that aren't well resolved, and for which side-chains could not be modeled. (UNK)s were substituted in the original sequence of the crystallized protein. Remaining misalignments result from differences in the distribution of (UNK)s between the two instances of the molecule in the structure. Here is the original sequence ot the crystallized protein : SNVVQARDNSQVFGVARIYASFNDTFVHVTDLSGKETIARVTGGMKVKADRDESSPYAAMLAAQDVAAKCKEVGITAVHV KIRATGGTRTKTPGPGGQAALRALARSGLRIGRIEDVTPVPSDSTRKKGGRRGRRL 4932
36 5DC3 16 C4, c4 40S ribosomal protein S14-A 4932
37 5DGF 16 C4, c4 40S ribosomal protein S14-A 4932
38 4V5O 20 AK, BK RPS14E 5911
39 5TGM 16 C4, c4 40S ribosomal protein S14-A 4932
40 4V7R 9 AH, CH 40S ribosomal protein S14-A 4932
41 5VYC 15 O1, O2, O3, O4, O5, O6 40S ribosomal protein S14 9606
42 4KZZ 15 O 40S Ribosomal Protein S14 9986
43 4KZX 15 O 40S ribosomal protein S14 9986
44 4KZY 15 O 40S Ribosomal Protein S14 9986
45 6YAL 17 Q 40S ribosomal protein uS11 9986
46 6YAM 17 Q 40S ribosomal protein uS11 9986
47 6YAN 16 Q 40S ribosomal protein uS11 9986
48 6W2S 13 P uS11 9986
49 6W2T 12 P uS11 9986
50 6Y7C 14 O 40S ribosomal protein S14-A 4932
51 6Y57 63 SO 40S ribosomal protein S14 9606
52 6Y2L 63 SO 40S ribosomal protein S14 9606
53 6Y0G 64 SO 40S ribosomal protein S14 9606
54 6TNU 18 Z 40S ribosomal protein S14-B 4932
55 6UZ7 62 O 40S ribosomal protein S14 28985
56 6TB3 18 Z 40S ribosomal protein S14-B 4932
57 6T83 17 Ob, p 40S ribosomal protein S14-A 4932
58 6T7T 19 SO 40S ribosomal protein S14-B 4932
59 6T7I 17 SO 40S ribosomal protein S14-A 4932
60 6T4Q 16 SO 40S ribosomal protein S14-B 4932
61 6SV4 33 Z, Zb, Zc 40S ribosomal protein S14-A 4932
62 6SNT 17 O 40S ribosomal protein S14-A 4932
63 6SGC 16 P1 uS11 9986
64 6S47 60 BP 40S ribosomal protein S14-A 4932
65 6RXT 39 Ci 40S ribosomal protein S14-like protein 209285
66 6RXU 42 Ci 40S ribosomal protein S14-like protein 209285
67 6RXV 42 Ci 40S ribosomal protein S14-like protein 209285
68 6RXX 24 Ci 40S ribosomal protein S14-like protein 209285
69 6RXY 38 Ci 40S ribosomal protein S14-like protein 209285
70 6RXZ 41 Ci 40S ribosomal protein S14-like protein 209285
71 6P5I 16 P uS11 9986
72 6P5J 16 P uS11 9986
73 6P5K 62 P uS11 9986
74 6P5N 62 P uS11 9986
75 6P4G 16 P uS11 9986
76 6P4H 17 P uS11 9986
77 6OM7 28 SO 40S ribosomal protein S14 9606
78 6OLZ 61 BO 40S ribosomal protein S14 9606
79 6OM0 28 SO 40S ribosomal protein S14 9606
80 6OLE 28 SO 40S ribosomal protein S14 9606
81 6OLF 28 SO 40S ribosomal protein S14 9606
82 6OLG 64 BO 40S ribosomal protein S14 9606
83 6OLI 28 SO 40S ribosomal protein S14 9606
84 6OKK 16 P 40S ribosomal protein S11 5833
85 6RBD 27 O 40S ribosomal protein S14-A 4932
86 6RBE 12 O 40S ribosomal protein S14-A 4932
87 6R7Q 13 MM uS11 9986
88 6R6G 36 MM 40S ribosomal protein S14 9986
89 6R6P 62 MM uS11 9986
90 6R5Q 66 MM uS11 9986
91 6QZP 75 SO 40S ribosomal protein S14 9606
92 6Q8Y 81 Z 40S ribosomal protein S14-B 4932
93 6I7O 33 Z, Zb 40S ribosomal protein S14-B 4932
94 6IP5 74 3L 40S ribosomal protein S14 9606
95 6IP6 73 3L 40S ribosomal protein S14 9606
96 6IP8 73 3L 40S ribosomal protein S14 9606
97 6MTB 65 OO 40S ribosomal protein S14 9986
98 6MTC 64 OO 40S ribosomal protein S14 9986
99 6MTD 66 OO uS11 9986
100 6MTE 65 OO uS11 9986
101 6HCQ 19 P2 uS11 9986
102 6HCJ 19 P2 uS11 9986
103 6HCM 16 P1 uS11 9986
104 6HCF 16 P1 uS11 9986
105 6GZ3 31 BO ribosomal protein uS11 9986
106 6GZ4 34 BO ribosomal protein uS11 9986
107 6GZ5 31 BO ribosomal protein uS11 9986
108 6GSM 18 O 40S ribosomal protein S14 28985
109 6GSN 38 O 40S ribosomal protein S14 28985
110 6GQV 62 AE 40S ribosomal protein S14-B 4932
111 6GQ1 62 AE 40S ribosomal protein S14-B 4932
112 6GQB 62 AE 40S ribosomal protein S14-B 4932
113 6D9J 64 PP uS11 9986
114 6D90 65 PP uS11 9986
115 6G5H 12 O 40S ribosomal protein S14 9606
116 6G5I 16 O 40S ribosomal protein S14 9606
117 6G4S 27 O 40S ribosomal protein S14 9606
118 6G4W 23 O 40S ribosomal protein S14 9606
119 6G51 13 O 40S ribosomal protein S14 9606
120 6G53 13 O 40S ribosomal protein S14 9606
121 6G18 23 O 40S ribosomal protein S14 9606
122 6FYX 18 O 40S ribosomal protein S14 28985
123 6FYY 18 O 40S ribosomal protein S14 28985
124 6FEC 38 j 40S ribosomal protein S14 9606
125 6FAI 25 O 40S ribosomal protein S14-A 4932
126 6EML 22 Z 40S ribosomal protein S14-A 4932
127 6EK0 75 SO 40S ribosomal protein S14 9606
128 6AZ1 15 O ribosomal protein S11 5661
129 5OQL 42 t 40S ribosomal protein S14-like protein 209285
130 5OPT 14 V 40S ribosomal protein S14, putative 5693
131 5WLC 40 NG rpS14_uS11 4932
132 5XYI 16 O Ribosomal protein S14 5722
133 5XXU 16 O Ribosomal protein uS11 5811
134 5OA3 19 O 40S ribosomal protein S14 9606
135 5WYJ 45 SP 40S ribosomal protein S14-A 4932
136 5WYK 41 SP 40S ribosomal protein S14-A 4932
137 5MC6 27 Z 40S ribosomal protein S14-A 4932
138 5M1J 22 O2 40S ribosomal protein S14-A 4932
139 5LZS 65 OO uS11 9986
140 5LZT 66 OO uS11 9986
141 5LZU 65 OO uS11 9986
142 5LZV 66 OO uS11 9986
143 5LZW 66 OO uS11 9986
144 5LZX 66 OO uS11 9986
145 5LZY 64 OO uS11 9986
146 5LZZ 66 OO uS11 9986
147 5T2A 63 AH uS11 5661
148 5T2C 80 AO 40S ribosomal protein S14 9606
149 5LL6 12 Z 40S ribosomal protein S14-A 4932
150 5LKS 74 SO 40S ribosomal protein S14 9606
151 5K0Y 32 j ribosomal protein uS11 9986
152 5JUO 64 LB uS11 (yeast S14) 4932
153 5JUP 64 LB uS11 (yeast S14) 4932
154 5JUS 64 LB uS11 (yeast S14) 4932
155 5JUT 64 LB uS11 (yeast S14) 4932
156 5JUU 64 LB uS11 (yeast S14) 4932
157 5JPQ 29 w uS11 209285
158 5IT7 62 O 40S ribosomal protein S14 28985
159 5IT9 15 O Ribosomal protein uS14 28985
160 5FLX 16 O 40S RIBOSOMAL PROTEIN S14 9986
161 3JAP 18 O uS11 28985
162 3JAQ 18 O uS11 28985
163 3JAM 16 O uS11 28985
164 3JAN 64 SO Ribosomal protein uS11 SEE REMARK 999 9986
165 3JAJ 65 SO Ribosomal protein uS11 SEE REMARK 999 9986
166 3JAG 66 OO uS11 9986
167 3JAH 66 OO uS11 9986
168 3JAI 66 OO uS11 9986
169 5A2Q 17 O RIBOSOMAL PROTEIN US11 9606
170 4UG0 76 SO 40S RIBOSOMAL PROTEIN S14 9606
171 5AJ0 64 BO 40S ribosomal protein S14 9606
172 4UER 21 K US11 4934
173 4D61 16 O 40S RIBOSOMAL PROTEIN S14 9986
174 4D5L 16 O 40S RIBOSOMAL PROTEIN US11 9986
175 3J81 16 O uS11 28985
176 3J80 12 O uS11 28985
177 3J7P 64 SO Ribosomal protein uS11 9823
178 3J7R 65 SO Ribosomal protein uS11 9823
179 4UJC 65 CO 40S RIBOSOMAL PROTEIN US11 9986
180 4UJD 65 CO 40S RIBOSOMAL PROTEIN ES11 9986
181 3J7A 16 P 40S ribosomal protein uS11 5833
182 3J77 60 14 40S ribosomal protein S14 4932
183 3J78 60 14 40S ribosomal protein S14 4932
184 3J6X 61 14 40S ribosomal protein S14 4932
185 3J6Y 61 14 40S ribosomal protein S14 4932
186 4UJE 19 BO 40S RIBOSOMAL PROTEIN S14 9986
187 4V92 17 BO US11 28985
188 4V7E 16 BO 40S ribosomal protein S11 4565
189 4V8Y 23 AO 40S RIBOSOMAL PROTEIN S14-A 4932
190 4V8Z 23 AO 40S RIBOSOMAL PROTEIN S14-A 4932
191 4V6W 5 AO 40S ribosomal protein S14 7227
192 4V6X 5 AO 40S ribosomal protein S14 9606
193 4V8M 16 AH 40S RIBOSOMAL PROTEIN S14 185431
194 3J0O 12 K Ribosomal protein S14 9986
195 3J0L 12 K Ribosomal protein S14 9986
196 4V6I 12 AK 40S ribosomal protein rpS14 (S11p) 4932
197 4V7H 10 AK 40S ribosomal protein S14(A) 5541
198 4V5Z 18 Ak 40S Ribosomal protein S14e 9612
199 4V4B 11 AK 40S ribosomal protein S14-A 4932