6RXV

Cryo-EM structure of the 90S pre-ribosome (Kre33-Noc4) from Chaetomium thermophilum, state B2


Sequence Similarity Clusters for the Entities in PDB 6RXV

Entity #1 | Chains: UA
Periodic tryptophan protein 2-like protein protein, length: 904 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13015
95 % 3 7 12975
90 % 3 7 12803
70 % 3 7 12170
50 % 3 11 7348
40 % 3 11 7091
30 % 3 11 6647
Entity #10 | Chains: UM
Utp13 protein, length: 912 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13164
95 % 3 7 13280
90 % 3 7 13097
70 % 3 7 12430
50 % 3 7 11350
40 % 3 7 10678
30 % 3 7 9866
Entity #11 | Chains: UN
Utp14 protein, length: 938 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13013
95 % 3 7 12973
90 % 3 7 12802
70 % 3 7 12160
50 % 3 7 11102
40 % 3 7 10447
30 % 3 7 9655
Entity #12 | Chains: UO
Utp15 protein, length: 557 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13562
95 % 3 7 12806
90 % 3 7 12773
70 % 3 7 12139
50 % 3 7 11081
40 % 3 7 10426
30 % 3 9 7946
Entity #13 | Chains: UQ
Utp17 protein, length: 960 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 12918
95 % 3 7 13068
90 % 3 7 12616
70 % 3 7 12006
50 % 3 7 10966
40 % 3 7 10524
30 % 3 7 9536
Entity #14 | Chains: UR
Utp18 protein, length: 618 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13792
95 % 3 7 13418
90 % 3 7 13248
70 % 3 7 12559
50 % 3 7 11462
40 % 3 7 10798
30 % 3 11 6708
Entity #15 | Chains: UU
Utp21 protein, length: 1049 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13795
95 % 3 7 13419
90 % 3 7 13249
70 % 3 7 12560
50 % 3 7 11463
40 % 3 7 10799
30 % 3 7 9968
Entity #16 | Chains: UX
Utp24 protein, length: 193 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 8 12483
95 % 3 8 11830
90 % 3 8 10879
70 % 3 8 11196
50 % 3 12 6488
40 % 3 12 6293
30 % 3 12 5979
Entity #17 | Chains: UZ
Utp30 protein, length: 391 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13561
95 % 3 7 12940
90 % 3 7 12772
70 % 3 7 12138
50 % 3 7 11080
40 % 3 7 10425
30 % 3 7 9637
Entity #18 | Chains: CA,CB
Nop1 protein, length: 313 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 5071
95 % 3 7 5926
90 % 3 7 5956
70 % 3 7 5874
50 % 3 11 3585
40 % 3 11 3564
30 % 3 11 3491
Entity #19 | Chains: CC
Nop56 protein, length: 523 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 14001
95 % 3 7 13820
90 % 3 7 13636
70 % 3 7 12932
50 % 3 11 7602
40 % 3 14 5633
30 % 3 14 5559
Entity #2 | Chains: UB
Utp2 protein, length: 907 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13606
95 % 3 7 13037
90 % 3 7 12868
70 % 3 7 12525
50 % 3 7 11155
40 % 3 7 10503
30 % 3 7 9701
Entity #20 | Chains: CD
Nop58 protein, length: 582 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13971
95 % 3 7 13350
90 % 3 7 13175
70 % 3 7 12898
50 % 3 7 11776
40 % 3 7 10732
30 % 3 7 10220
Entity #21 | Chains: CE,CF
Snu13 protein, length: 127 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 5294
95 % 3 7 5944
90 % 3 7 6373
70 % 3 7 6271
50 % 12 34 1395
40 % 13 35 1389
30 % 12 34 1481
Entity #22 | Chains: CG
Rrp9 protein, length: 630 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13610
95 % 3 7 13362
90 % 3 7 13188
70 % 3 7 12498
50 % 3 7 11158
40 % 3 7 10741
30 % 3 7 9915
Entity #23 | Chains: CH
RNA 3'-terminal phosphate cyclase-like protein protein, length: 411 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13860
95 % 3 7 13719
90 % 3 7 13399
70 % 3 7 12701
50 % 3 7 11586
40 % 3 7 10921
30 % 3 7 10071
Entity #24 | Chains: CI
Bms1 protein, length: 1163 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13970
95 % 3 7 13776
90 % 3 7 13600
70 % 3 7 12322
50 % 3 7 11775
40 % 3 11 7354
30 % 3 11 6906
Entity #25 | Chains: CJ
Imp3 protein, length: 183 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 8 12779
95 % 3 8 12564
90 % 3 8 12386
70 % 3 8 11922
50 % 3 12 6593
40 % 3 12 6407
30 % 3 12 6071
Entity #26 | Chains: CK
Imp4 protein, length: 297 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 8 11149
95 % 3 8 12385
90 % 3 8 12212
70 % 3 8 11659
50 % 3 11 7448
40 % 3 11 7187
30 % 3 11 6746
Entity #27 | Chains: CL
Mpp10 protein, length: 785 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 12932
95 % 3 7 12951
90 % 3 7 12782
70 % 3 7 12152
50 % 3 7 10985
40 % 3 7 10295
30 % 3 7 9554
Entity #28 | Chains: CM
Sof1 protein, length: 446 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13165
95 % 3 7 13284
90 % 3 7 13100
70 % 3 7 12431
50 % 3 7 11351
40 % 3 9 8516
30 % 3 9 7960
Entity #29 | Chains: CN,CO
Emg1 protein, length: 252 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 5599
95 % 3 7 6404
90 % 3 7 6415
70 % 8 17 2464
50 % 8 17 2445
40 % 8 17 2467
30 % 8 17 2500
Entity #3 | Chains: UC
Utp3 protein, length: 648 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13014
95 % 3 7 12974
90 % 3 7 12588
70 % 3 7 12169
50 % 3 7 11095
40 % 3 7 10441
30 % 3 7 9656
Entity #30 | Chains: CP
KRR1 small subunit processome component protein, length: 322 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 8 9669
95 % 3 8 9968
90 % 3 8 10225
70 % 3 11 7662
50 % 3 11 7202
40 % 3 11 6951
30 % 3 11 6531
Entity #31 | Chains: CQ
Pre-rRNA-processing protein PNO1 protein, length: 259 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13589
95 % 3 7 13085
90 % 3 7 13382
70 % 3 7 12189
50 % 3 7 11117
40 % 3 7 10460
30 % 3 7 9668
Entity #32 | Chains: CR,CS
Kre33 protein, length: 1073 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 8 4249
95 % 3 8 5167
90 % 3 8 5218
70 % 3 8 5166
50 % 3 8 5018
40 % 3 8 4912
30 % 3 8 4747
Entity #33 | Chains: CT
Fcf2 protein, length: 203 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 12895
95 % 3 7 12873
90 % 3 7 12570
70 % 3 7 11989
50 % 3 7 10919
40 % 3 7 10269
30 % 3 7 9496
Entity #34 | Chains: Ca
40S ribosomal protein S1 protein, length: 255 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 5 19029
95 % 3 5 19069
90 % 3 5 17864
70 % 51 91 458
50 % 65 157 330
40 % 65 161 333
30 % 65 161 354
Entity #35 | Chains: Cb
40S ribosomal protein S4 protein, length: 264 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 5 20596
95 % 2 5 18787
90 % 2 5 18402
70 % 63 181 256
50 % 65 191 244
40 % 65 195 249
30 % 69 204 247
Entity #36 | Chains: Cc
40S ribosomal protein s5-like protein protein, length: 212 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13095
95 % 3 7 13124
90 % 3 7 12950
70 % 16 101 607
50 % 67 201 218
40 % 67 201 236
30 % 67 201 251
Entity #37 | Chains: Cd
40S ribosomal protein S6 protein, length: 239 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 5 20595
95 % 2 5 18786
90 % 2 5 18401
70 % 15 91 674
50 % 64 182 282
40 % 64 187 285
30 % 64 187 302
Entity #38 | Chains: Ce
40S ribosomal protein S7 protein, length: 203 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13064
95 % 3 7 13593
90 % 3 7 12900
70 % 3 7 12261
50 % 64 188 260
40 % 64 188 278
30 % 66 191 275
Entity #39 | Chains: Cf
40S ribosomal protein S8 protein, length: 202 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 5 20838
95 % 2 5 19192
90 % 2 5 17897
70 % 50 93 447
50 % 65 190 248
40 % 65 194 251
30 % 65 194 265
Entity #4 | Chains: UD
Utp4 protein, length: 884 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 4 8 9393
95 % 4 8 10253
90 % 4 8 10162
70 % 4 8 9870
50 % 4 8 9179
40 % 4 8 8784
30 % 4 8 8191
Entity #40 | Chains: Cg
40S ribosomal protein s9-like protein protein, length: 190 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13701
95 % 3 7 13544
90 % 3 7 13065
70 % 65 185 242
50 % 67 200 220
40 % 71 208 226
30 % 71 208 240
Entity #41 | Chains: Ch
40S ribosomal protein S13-like protein protein, length: 151 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13249
95 % 3 7 13443
90 % 3 7 13272
70 % 65 190 232
50 % 67 197 232
40 % 71 205 230
30 % 71 206 244
Entity #42 | Chains: Ci
40S ribosomal protein S14-like protein protein, length: 150 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13065
95 % 3 7 13077
90 % 15 81 751
70 % 67 198 196
50 % 67 199 225
40 % 67 199 238
30 % 67 199 254
Entity #43 | Chains: Cj
40S ribosomal protein S16-like protein protein, length: 143 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13811
95 % 3 7 13458
90 % 3 7 13284
70 % 3 7 12597
50 % 65 190 242
40 % 69 198 240
30 % 69 199 253
Entity #44 | Chains: Ck
40S ribosomal protein S11-like protein protein, length: 161 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 5 19227
95 % 2 5 18541
90 % 2 5 18403
70 % 51 95 438
50 % 66 197 231
40 % 66 197 244
30 % 66 197 258
Entity #45 | Chains: Cm
40S ribosomal protein S22-like protein protein, length: 130 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13702
95 % 3 7 13252
90 % 3 7 13066
70 % 66 201 202
50 % 68 203 215
40 % 73 212 223
30 % 437 775 21
Entity #46 | Chains: Cn
40S ribosomal protein s23-like protein protein, length: 145 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13703
95 % 3 7 13545
90 % 3 7 13067
70 % 67 204 184
50 % 71 214 205
40 % 71 214 220
30 % 71 214 233
Entity #47 | Chains: Co
40S ribosomal protein S24 protein, length: 136 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 5 19228
95 % 2 5 18542
90 % 2 5 18162
70 % 50 95 441
50 % 63 192 250
40 % 63 192 266
30 % 63 192 280
Entity #48 | Chains: Cp
40S ribosomal protein S28-like protein protein, length: 68 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13058
95 % 3 7 13065
90 % 3 7 12893
70 % 65 191 229
50 % 71 202 216
40 % 71 203 232
30 % 71 203 246
Entity #49 | Chains: CU
Faf1 protein, length: 311 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13059
95 % 3 7 13552
90 % 3 7 13378
70 % 3 7 12371
50 % 3 7 11173
40 % 3 7 10521
30 % 3 7 9719
Entity #5 | Chains: UF
Utp6 protein, length: 414 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13621
95 % 3 7 13080
90 % 3 7 12903
70 % 3 7 12263
50 % 3 7 11188
40 % 3 7 10534
30 % 3 7 9731
Entity #50 | Chains: C1
35S ribosomal RNA rna, length: 2352 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
Entity #51 | Chains: C2
U3 snoRNA rna, length: 230 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
Entity #52 | Chains: UV
U3 small nucleolar RNA-associated protein 22 protein, length: 1171 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 4 23108
95 % 1 4 24705
90 % 1 4 23987
70 % 1 4 21835
50 % 1 4 17748
40 % 1 4 17742
30 % 1 4 14804
Entity #53 | Chains: CV
Rrp7 protein, length: 322 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 4 31184
95 % 1 4 26307
90 % 1 4 25680
70 % 1 4 23179
50 % 1 4 20401
40 % 1 4 18671
30 % 1 4 16858
Entity #54 | Chains: CW
Ribosome biogenesis protein ENP2 protein, length: 668 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 4 31065
95 % 2 4 26153
90 % 2 4 25322
70 % 2 4 19148
50 % 2 4 18933
40 % 2 4 15831
30 % 2 4 15689
Entity #55 | Chains: UT
Utp20 protein, length: 2612 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 4 29271
95 % 2 4 23211
90 % 2 4 22580
70 % 2 4 20989
50 % 2 4 18602
40 % 2 4 16853
30 % 2 4 15446
Entity #56 | Chains: UH
Utp8 protein, length: 930 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 6 15473
95 % 3 6 17073
90 % 3 6 16748
70 % 3 6 14880
50 % 3 6 14157
40 % 3 6 12550
30 % 3 6 11506
Entity #57 | Chains: UE,UI
Utp5 protein, length: 410 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 6 6897
95 % 3 6 7526
90 % 3 6 7484
70 % 3 6 6970
50 % 3 6 6935
40 % 3 6 6468
30 % 3 6 6124
Entity #58 | Chains: US
Noc4 protein, length: 549 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 6 17406
95 % 3 6 15719
90 % 3 6 15056
70 % 3 6 14521
50 % 3 6 13182
40 % 3 6 12294
30 % 3 6 11278
Entity #59 | Chains: Cl
Rps18 protein, length: 156 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 6 16807
95 % 3 6 14786
90 % 3 6 14558
70 % 65 183 247
50 % 67 192 239
40 % 71 202 233
30 % 71 202 248
Entity #6 | Chains: UG
Utp7 protein, length: 558 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13377
95 % 3 7 13698
90 % 3 7 13521
70 % 3 7 12812
50 % 3 7 11695
40 % 3 9 8250
30 % 3 9 7862
Entity #60 | Chains: CX
Enp1 protein, length: 480 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 6 17237
95 % 3 6 17139
90 % 3 6 16833
70 % 3 6 15839
50 % 3 6 12998
40 % 3 6 12141
30 % 4 15 5037
Entity #61 | Chains: CY
U3 small nucleolar ribonucleoprotein protein lcp5-like protein protein, length: 381 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 3 34825
95 % 2 3 26752
90 % 2 3 25876
70 % 2 3 23534
50 % 2 3 20708
40 % 2 3 18943
30 % 2 3 16972
Entity #62 | Chains: CZ
Bfr2 protein, length: 609 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 4 26311
95 % 2 4 19513
90 % 2 4 19113
70 % 2 4 17746
50 % 2 4 15948
40 % 2 4 14813
30 % 2 4 13458
Entity #63 | Chains: UP
Utp16 protein, length: 364 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 6 17407
95 % 3 6 14515
90 % 3 6 14307
70 % 3 6 14522
50 % 3 6 13183
40 % 3 6 12295
30 % 3 6 10660
Entity #7 | Chains: UJ
UTP10 protein, length: 1802 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 8 11162
95 % 3 8 12402
90 % 3 8 12230
70 % 3 8 11680
50 % 3 8 10702
40 % 3 8 10064
30 % 3 8 9298
Entity #8 | Chains: UK
U3 small nucleolar RNA-associated protein 11 protein, length: 270 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13378
95 % 3 7 13699
90 % 3 7 13522
70 % 3 7 12813
50 % 3 7 11696
40 % 3 7 11018
30 % 3 7 10161
Entity #9 | Chains: UL
Utp12 protein, length: 962 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13992
95 % 3 7 13546
90 % 3 7 13371
70 % 3 7 12926
50 % 3 7 11809
40 % 3 11 7047
30 % 3 11 6606

Instructions

In the table for each entity, view a list of similar sequences by selecting the link associated with the percentage cutoff.



View more detailed documentation on the redundancy reduction and sequence clustering procedure used by RCSB PDB.

You can also use the structure comparison tool to compare any 2 given structures


ACTION - (A) Select for download / view details OR (B) Select two chains for comparison
Rank PDB ID Entity ID Chains Description Details Taxonomy EC Number
1 4V88 16 AO, CO 40S ribosomal protein S14-A 4932
2 4U4R 16 C4, c4 40S ribosomal protein S14-A 4932
3 4U3U 16 C4, c4 40S ribosomal protein S14-A 4932
4 5TBW 63 P, c4 40S ribosomal protein S14-B 4932
5 4U3M 16 C4, c4 40S ribosomal protein S14-A 4932
6 4U3N 16 C4, c4 40S ribosomal protein S14-A 4932
7 4U52 16 C4, c4 40S ribosomal protein S14-A 4932
8 4U4Q 16 C4, c4 40S ribosomal protein S14-A 4932
9 4U6F 16 C4, c4 40S ribosomal protein S14-A 4932
10 4U4U 16 C4, c4 40S ribosomal protein S14-A 4932
11 4U4Z 16 C4, c4 40S ribosomal protein S14-A 4932
12 4U4Y 16 C4, c4 40S ribosomal protein S14-A 4932
13 4U4N 16 C4, c4 40S ribosomal protein S14-A 4932
14 4U55 16 C4, c4 40S ribosomal protein S14-A 4932
15 5DAT 16 C4, c4 40S ribosomal protein S14-A 4932
16 5I4L 16 C4, c4 40S ribosomal protein S14-B 4932
17 4U51 16 C4, c4 40S ribosomal protein S14-A 4932
18 6HHQ 62 P, c4 40S ribosomal protein S14-B 4932
19 5OBM 60 C4, c4 40S ribosomal protein S14-B 4932
20 4U53 16 C4, c4 40S ribosomal protein S14-A 4932
21 5ON6 64 P, c4 40S ribosomal protein S14-B 4932
22 4U50 16 C4, c4 40S ribosomal protein S14-A 4932
23 5NDV 60 C4, c4 40S ribosomal protein S14-B 4932
24 5LYB 16 C4, c4 40S Ribosomal Protein S14 4932
25 4U56 16 C4, c4 40S ribosomal protein S14-A 4932
26 5TGA 16 C4, c4 40S ribosomal protein S14-B 4932
27 5MEI 63 P, c4 40S ribosomal protein S14-B 4932
28 5FCJ 16 C4, c4 40S ribosomal protein S14-A (UNK) residues correspond to residues that aren't well resolved, and for which side-chains could not be modeled. (UNK)s were substituted in the original sequence of the crystallized protein. Remaining misalignments result from differences in the distribution of (UNK)s between the two instances of the molecule in the structure. Here is the original sequence ot the crystallized protein : SNVVQARDNSQVFGVARIYASFNDTFVHVTDLSGKETIARVTGGMKVKADRDESSPYAAMLAAQDVAAKCKEVGITAVHV KIRATGGTRTKTPGPGGQAALRALARSGLRIGRIEDVTPVPSDSTRKKGGRRGRRL 4932
29 4U4O 16 C4, c4 40S ribosomal protein S14-A 4932
30 5DGV 16 C4, c4 40S ribosomal protein S14-A 4932
31 5DGE 16 C4, c4 40S ribosomal protein S14-A 4932
32 5NDW 9 C4, c4 40S ribosomal protein S14-B 4932
33 4BTS 21 AK, BK, CK, DK 40S RIBOSOMAL PROTEIN RPS14E 5911
34 5NDG 16 C4, c4 40S ribosomal protein S14-A 4932
35 5FCI 16 C4, c4 40S ribosomal protein S14-A (UNK) residues correspond to residues that aren't well resolved, and for which side-chains could not be modeled. (UNK)s were substituted in the original sequence of the crystallized protein. Remaining misalignments result from differences in the distribution of (UNK)s between the two instances of the molecule in the structure. Here is the original sequence ot the crystallized protein : SNVVQARDNSQVFGVARIYASFNDTFVHVTDLSGKETIARVTGGMKVKADRDESSPYAAMLAAQDVAAKCKEVGITAVHV KIRATGGTRTKTPGPGGQAALRALARSGLRIGRIEDVTPVPSDSTRKKGGRRGRRL 4932
36 5DC3 16 C4, c4 40S ribosomal protein S14-A 4932
37 5DGF 16 C4, c4 40S ribosomal protein S14-A 4932
38 4V5O 20 AK, BK RPS14E 5911
39 5TGM 16 C4, c4 40S ribosomal protein S14-A 4932
40 4V7R 9 AH, CH 40S ribosomal protein S14-A 4932
41 5VYC 15 O1, O2, O3, O4, O5, O6 40S ribosomal protein S14 9606
42 4KZZ 15 O 40S Ribosomal Protein S14 9986
43 4KZX 15 O 40S ribosomal protein S14 9986
44 4KZY 15 O 40S Ribosomal Protein S14 9986
45 6YAL 17 Q 40S ribosomal protein uS11 9986
46 6YAM 17 Q 40S ribosomal protein uS11 9986
47 6YAN 16 Q 40S ribosomal protein uS11 9986
48 6W2S 13 P uS11 9986
49 6W2T 12 P uS11 9986
50 6Y7C 14 O 40S ribosomal protein S14-A 4932
51 6Y57 63 SO 40S ribosomal protein S14 9606
52 6Y2L 63 SO 40S ribosomal protein S14 9606
53 6Y0G 64 SO 40S ribosomal protein S14 9606
54 6TNU 18 Z 40S ribosomal protein S14-B 4932
55 6UZ7 62 O 40S ribosomal protein S14 28985
56 6TB3 18 Z 40S ribosomal protein S14-B 4932
57 6T83 17 Ob, p 40S ribosomal protein S14-A 4932
58 6T7T 19 SO 40S ribosomal protein S14-B 4932
59 6T7I 17 SO 40S ribosomal protein S14-A 4932
60 6T4Q 16 SO 40S ribosomal protein S14-B 4932
61 6SV4 33 Z, Zb, Zc 40S ribosomal protein S14-A 4932
62 6SNT 17 O 40S ribosomal protein S14-A 4932
63 6SGC 16 P1 uS11 9986
64 6S47 60 BP 40S ribosomal protein S14-A 4932
65 6RXT 39 Ci 40S ribosomal protein S14-like protein 209285
66 6RXU 42 Ci 40S ribosomal protein S14-like protein 209285
67 6RXV 42 Ci 40S ribosomal protein S14-like protein 209285
68 6RXX 24 Ci 40S ribosomal protein S14-like protein 209285
69 6RXY 38 Ci 40S ribosomal protein S14-like protein 209285
70 6RXZ 41 Ci 40S ribosomal protein S14-like protein 209285
71 6P5I 16 P uS11 9986
72 6P5J 16 P uS11 9986
73 6P5K 62 P uS11 9986
74 6P5N 62 P uS11 9986
75 6P4G 16 P uS11 9986
76 6P4H 17 P uS11 9986
77 6OM7 28 SO 40S ribosomal protein S14 9606
78 6OLZ 61 BO 40S ribosomal protein S14 9606
79 6OM0 28 SO 40S ribosomal protein S14 9606
80 6OLE 28 SO 40S ribosomal protein S14 9606
81 6OLF 28 SO 40S ribosomal protein S14 9606
82 6OLG 64 BO 40S ribosomal protein S14 9606
83 6OLI 28 SO 40S ribosomal protein S14 9606
84 6OKK 16 P 40S ribosomal protein S11 5833
85 6RBD 27 O 40S ribosomal protein S14-A 4932
86 6RBE 12 O 40S ribosomal protein S14-A 4932
87 6R7Q 13 MM uS11 9986
88 6R6G 36 MM 40S ribosomal protein S14 9986
89 6R6P 62 MM uS11 9986
90 6R5Q 66 MM uS11 9986
91 6QZP 75 SO 40S ribosomal protein S14 9606
92 6Q8Y 81 Z 40S ribosomal protein S14-B 4932
93 6I7O 33 Z, Zb 40S ribosomal protein S14-B 4932
94 6IP5 74 3L 40S ribosomal protein S14 9606
95 6IP6 73 3L 40S ribosomal protein S14 9606
96 6IP8 73 3L 40S ribosomal protein S14 9606
97 6MTB 65 OO 40S ribosomal protein S14 9986
98 6MTC 64 OO 40S ribosomal protein S14 9986
99 6MTD 66 OO uS11 9986
100 6MTE 65 OO uS11 9986
101 6HCQ 19 P2 uS11 9986
102 6HCJ 19 P2 uS11 9986
103 6HCM 16 P1 uS11 9986
104 6HCF 16 P1 uS11 9986
105 6GZ3 31 BO ribosomal protein uS11 9986
106 6GZ4 34 BO ribosomal protein uS11 9986
107 6GZ5 31 BO ribosomal protein uS11 9986
108 6GSM 18 O 40S ribosomal protein S14 28985
109 6GSN 38 O 40S ribosomal protein S14 28985
110 6GQV 62 AE 40S ribosomal protein S14-B 4932
111 6GQ1 62 AE 40S ribosomal protein S14-B 4932
112 6GQB 62 AE 40S ribosomal protein S14-B 4932
113 6D9J 64 PP uS11 9986
114 6D90 65 PP uS11 9986
115 6G5H 12 O 40S ribosomal protein S14 9606
116 6G5I 16 O 40S ribosomal protein S14 9606
117 6G4S 27 O 40S ribosomal protein S14 9606
118 6G4W 23 O 40S ribosomal protein S14 9606
119 6G51 13 O 40S ribosomal protein S14 9606
120 6G53 13 O 40S ribosomal protein S14 9606
121 6G18 23 O 40S ribosomal protein S14 9606
122 6FYX 18 O 40S ribosomal protein S14 28985
123 6FYY 18 O 40S ribosomal protein S14 28985
124 6FEC 38 j 40S ribosomal protein S14 9606
125 6FAI 25 O 40S ribosomal protein S14-A 4932
126 6EML 22 Z 40S ribosomal protein S14-A 4932
127 6EK0 75 SO 40S ribosomal protein S14 9606
128 6AZ1 15 O ribosomal protein S11 5661
129 5OQL 42 t 40S ribosomal protein S14-like protein 209285
130 5OPT 14 V 40S ribosomal protein S14, putative 5693
131 5WLC 40 NG rpS14_uS11 4932
132 5XYI 16 O Ribosomal protein S14 5722
133 5XXU 16 O Ribosomal protein uS11 5811
134 5OA3 19 O 40S ribosomal protein S14 9606
135 5WYJ 45 SP 40S ribosomal protein S14-A 4932
136 5WYK 41 SP 40S ribosomal protein S14-A 4932
137 5MC6 27 Z 40S ribosomal protein S14-A 4932
138 5M1J 22 O2 40S ribosomal protein S14-A 4932
139 5LZS 65 OO uS11 9986
140 5LZT 66 OO uS11 9986
141 5LZU 65 OO uS11 9986
142 5LZV 66 OO uS11 9986
143 5LZW 66 OO uS11 9986
144 5LZX 66 OO uS11 9986
145 5LZY 64 OO uS11 9986
146 5LZZ 66 OO uS11 9986
147 5T2A 63 AH uS11 5661
148 5T2C 80 AO 40S ribosomal protein S14 9606
149 5LL6 12 Z 40S ribosomal protein S14-A 4932
150 5LKS 74 SO 40S ribosomal protein S14 9606
151 5K0Y 32 j ribosomal protein uS11 9986
152 5JUO 64 LB uS11 (yeast S14) 4932
153 5JUP 64 LB uS11 (yeast S14) 4932
154 5JUS 64 LB uS11 (yeast S14) 4932
155 5JUT 64 LB uS11 (yeast S14) 4932
156 5JUU 64 LB uS11 (yeast S14) 4932
157 5JPQ 29 w uS11 209285
158 5IT7 62 O 40S ribosomal protein S14 28985
159 5IT9 15 O Ribosomal protein uS14 28985
160 5FLX 16 O 40S RIBOSOMAL PROTEIN S14 9986
161 3JAP 18 O uS11 28985
162 3JAQ 18 O uS11 28985
163 3JAM 16 O uS11 28985
164 3JAN 64 SO Ribosomal protein uS11 SEE REMARK 999 9986
165 3JAJ 65 SO Ribosomal protein uS11 SEE REMARK 999 9986
166 3JAG 66 OO uS11 9986
167 3JAH 66 OO uS11 9986
168 3JAI 66 OO uS11 9986
169 5A2Q 17 O RIBOSOMAL PROTEIN US11 9606
170 4UG0 76 SO 40S RIBOSOMAL PROTEIN S14 9606
171 5AJ0 64 BO 40S ribosomal protein S14 9606
172 4UER 21 K US11 4934
173 4D61 16 O 40S RIBOSOMAL PROTEIN S14 9986
174 4D5L 16 O 40S RIBOSOMAL PROTEIN US11 9986
175 3J81 16 O uS11 28985
176 3J80 12 O uS11 28985
177 3J7P 64 SO Ribosomal protein uS11 9823
178 3J7R 65 SO Ribosomal protein uS11 9823
179 4UJC 65 CO 40S RIBOSOMAL PROTEIN US11 9986
180 4UJD 65 CO 40S RIBOSOMAL PROTEIN ES11 9986
181 3J7A 16 P 40S ribosomal protein uS11 5833
182 3J77 60 14 40S ribosomal protein S14 4932
183 3J78 60 14 40S ribosomal protein S14 4932
184 3J6X 61 14 40S ribosomal protein S14 4932
185 3J6Y 61 14 40S ribosomal protein S14 4932
186 4UJE 19 BO 40S RIBOSOMAL PROTEIN S14 9986
187 4V92 17 BO US11 28985
188 4V7E 16 BO 40S ribosomal protein S11 4565
189 4V8Y 23 AO 40S RIBOSOMAL PROTEIN S14-A 4932
190 4V8Z 23 AO 40S RIBOSOMAL PROTEIN S14-A 4932
191 4V6W 5 AO 40S ribosomal protein S14 7227
192 4V6X 5 AO 40S ribosomal protein S14 9606
193 4V8M 16 AH 40S RIBOSOMAL PROTEIN S14 185431
194 3J0O 12 K Ribosomal protein S14 9986
195 3J0L 12 K Ribosomal protein S14 9986
196 4V6I 12 AK 40S ribosomal protein rpS14 (S11p) 4932
197 4V7H 10 AK 40S ribosomal protein S14(A) 5541
198 4V5Z 18 Ak 40S Ribosomal protein S14e 9612
199 4V4B 11 AK 40S ribosomal protein S14-A 4932