6RXV

Cryo-EM structure of the 90S pre-ribosome (Kre33-Noc4) from Chaetomium thermophilum, state B2


Sequence Similarity Clusters for the Entities in PDB 6RXV

Entity #1 | Chains: UA
Periodic tryptophan protein 2-like protein protein, length: 904 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 14245
95 % 3 7 14024
90 % 3 7 13839
70 % 3 7 13096
50 % 3 11 7822
40 % 3 11 7528
30 % 3 11 7081
Entity #10 | Chains: UM
Utp13 protein, length: 912 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13821
95 % 3 7 13874
90 % 3 7 12998
70 % 3 7 12936
50 % 3 7 11237
40 % 3 7 10571
30 % 3 7 9769
Entity #11 | Chains: UN
Utp14 protein, length: 938 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13604
95 % 3 7 13141
90 % 3 7 12997
70 % 3 7 12315
50 % 3 7 11236
40 % 3 7 10570
30 % 3 7 9768
Entity #12 | Chains: UO
Utp15 protein, length: 557 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 14060
95 % 3 7 13641
90 % 3 7 13465
70 % 3 7 12756
50 % 3 7 11623
40 % 3 7 10930
30 % 3 9 8121
Entity #13 | Chains: UQ
Utp17 protein, length: 960 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13742
95 % 3 7 13142
90 % 3 7 12999
70 % 3 7 12316
50 % 3 7 11238
40 % 3 7 10572
30 % 3 7 9770
Entity #14 | Chains: UR
Utp18 protein, length: 618 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13286
95 % 3 7 13579
90 % 3 7 13391
70 % 3 7 12188
50 % 3 7 11121
40 % 3 7 10457
30 % 3 11 6966
Entity #15 | Chains: UU
Utp21 protein, length: 1049 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13625
95 % 3 7 13514
90 % 3 7 13339
70 % 3 7 12222
50 % 3 7 11512
40 % 3 7 10816
30 % 3 7 9995
Entity #16 | Chains: UX
Utp24 protein, length: 193 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 8 12708
95 % 3 8 12030
90 % 3 8 11088
70 % 3 8 11378
50 % 3 12 6775
40 % 3 12 6582
30 % 3 12 6232
Entity #17 | Chains: UZ
Utp30 protein, length: 391 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13732
95 % 3 7 12994
90 % 3 7 12822
70 % 3 7 12174
50 % 3 7 11108
40 % 3 7 10447
30 % 3 7 9668
Entity #18 | Chains: CA,CB
Nop1 protein, length: 313 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 5502
95 % 3 7 6124
90 % 3 7 6145
70 % 3 7 6050
50 % 3 11 3684
40 % 3 11 3662
30 % 3 11 3570
Entity #19 | Chains: CC
Nop56 protein, length: 523 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13639
95 % 3 7 13948
90 % 3 7 13338
70 % 3 7 13010
50 % 3 11 7834
40 % 3 15 5578
30 % 3 15 5326
Entity #2 | Chains: UB
Utp2 protein, length: 907 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 14267
95 % 3 7 14067
90 % 3 7 13879
70 % 3 7 13123
50 % 3 7 11978
40 % 3 7 11261
30 % 3 7 10396
Entity #20 | Chains: CD
Nop58 protein, length: 582 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 14147
95 % 3 7 14074
90 % 3 7 13884
70 % 3 7 13129
50 % 3 7 11984
40 % 3 7 11266
30 % 3 7 10400
Entity #21 | Chains: CE,CF
Snu13 protein, length: 127 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 5282
95 % 3 7 6231
90 % 3 7 6190
70 % 3 7 6155
50 % 12 34 1433
40 % 13 35 1417
30 % 12 34 1505
Entity #22 | Chains: CG
Rrp9 protein, length: 630 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13357
95 % 3 7 13388
90 % 3 7 13224
70 % 3 7 12517
50 % 3 7 11423
40 % 3 7 10732
30 % 3 7 9911
Entity #23 | Chains: CH
RNA 3'-terminal phosphate cyclase-like protein protein, length: 411 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 14110
95 % 3 7 13740
90 % 3 7 13573
70 % 3 7 12840
50 % 3 7 11693
40 % 3 7 11001
30 % 3 7 10160
Entity #24 | Chains: CI
Bms1 protein, length: 1163 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 14109
95 % 3 7 12993
90 % 3 7 12858
70 % 3 7 12209
50 % 3 7 11692
40 % 3 11 7533
30 % 3 11 7086
Entity #25 | Chains: CJ
Imp3 protein, length: 183 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 8 10665
95 % 3 8 11482
90 % 3 8 11386
70 % 3 8 10898
50 % 3 12 6888
40 % 3 12 6692
30 % 3 12 6323
Entity #26 | Chains: CK
Imp4 protein, length: 297 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 8 12633
95 % 3 8 11015
90 % 3 8 10916
70 % 3 8 11537
50 % 3 11 7795
40 % 3 11 7503
30 % 3 11 6923
Entity #27 | Chains: CL
Mpp10 protein, length: 785 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13557
95 % 3 7 13781
90 % 3 7 13610
70 % 3 7 12867
50 % 3 7 11719
40 % 3 7 11028
30 % 3 7 10183
Entity #28 | Chains: CM
Sof1 protein, length: 446 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 14024
95 % 3 7 13593
90 % 3 7 13406
70 % 3 7 12695
50 % 3 7 11558
40 % 3 9 8738
30 % 3 9 8185
Entity #29 | Chains: CN,CO
Emg1 protein, length: 252 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 5645
95 % 3 7 6407
90 % 3 7 6424
70 % 8 17 2475
50 % 8 17 2479
40 % 8 17 2544
30 % 8 17 2500
Entity #3 | Chains: UC
Utp3 protein, length: 648 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13878
95 % 3 7 13269
90 % 3 7 13126
70 % 3 7 12423
50 % 3 7 11344
40 % 3 7 10671
30 % 3 7 9851
Entity #30 | Chains: CP
KRR1 small subunit processome component protein, length: 322 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 8 9761
95 % 3 8 9986
90 % 3 8 10261
70 % 3 11 7201
50 % 3 11 6830
40 % 3 11 6563
30 % 3 11 6219
Entity #31 | Chains: CQ
Pre-rRNA-processing protein PNO1 protein, length: 259 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13887
95 % 3 7 13283
90 % 3 7 13145
70 % 3 7 12995
50 % 3 7 11361
40 % 3 7 11143
30 % 3 7 9863
Entity #32 | Chains: CR,CS
Kre33 protein, length: 1073 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 8 4428
95 % 3 8 5415
90 % 3 8 5685
70 % 3 8 5605
50 % 3 8 5388
40 % 3 8 5247
30 % 3 8 5032
Entity #33 | Chains: CT
Fcf2 protein, length: 203 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13289
95 % 3 7 13261
90 % 3 7 13118
70 % 3 7 12917
50 % 3 7 11341
40 % 3 7 11075
30 % 3 7 10221
Entity #34 | Chains: Ca
40S ribosomal protein S1 protein, length: 255 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 5 21226
95 % 3 5 19534
90 % 3 5 19129
70 % 51 91 471
50 % 53 97 472
40 % 66 162 337
30 % 66 162 356
Entity #35 | Chains: Cb
40S ribosomal protein S4 protein, length: 264 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 5 21225
95 % 2 5 19533
90 % 2 5 18289
70 % 64 182 262
50 % 66 192 253
40 % 66 192 265
30 % 70 200 263
Entity #36 | Chains: Cc
40S ribosomal protein s5-like protein protein, length: 212 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13324
95 % 3 7 13335
90 % 3 7 13184
70 % 18 103 596
50 % 69 203 229
40 % 69 203 242
30 % 69 203 256
Entity #37 | Chains: Cd
40S ribosomal protein S6 protein, length: 239 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 5 20359
95 % 2 5 18221
90 % 2 5 17738
70 % 16 92 691
50 % 65 183 288
40 % 65 188 290
30 % 65 188 310
Entity #38 | Chains: Ce
40S ribosomal protein S7 protein, length: 203 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13143
95 % 3 7 12995
90 % 3 7 12788
70 % 3 7 12263
50 % 65 189 269
40 % 65 189 286
30 % 67 192 282
Entity #39 | Chains: Cf
40S ribosomal protein S8 protein, length: 202 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 5 20697
95 % 2 5 19535
90 % 2 5 18290
70 % 50 93 461
50 % 66 191 256
40 % 66 195 257
30 % 66 195 273
Entity #4 | Chains: UD
Utp4 protein, length: 884 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 4 8 9582
95 % 4 8 10438
90 % 4 8 10346
70 % 4 8 10040
50 % 4 8 9362
40 % 4 8 8943
30 % 4 8 8359
Entity #40 | Chains: Cg
40S ribosomal protein s9-like protein protein, length: 190 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13556
95 % 3 7 13482
90 % 3 7 13608
70 % 66 186 251
50 % 68 201 235
40 % 72 209 235
30 % 72 209 247
Entity #41 | Chains: Ch
40S ribosomal protein S13-like protein protein, length: 151 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13971
95 % 3 7 13481
90 % 3 7 13304
70 % 66 195 241
50 % 68 198 242
40 % 72 206 238
30 % 72 207 249
Entity #42 | Chains: Ci
40S ribosomal protein S14-like protein protein, length: 150 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13290
95 % 3 7 13262
90 % 16 82 764
70 % 68 199 228
50 % 68 200 237
40 % 68 200 248
30 % 68 200 262
Entity #43 | Chains: Cj
40S ribosomal protein S16-like protein protein, length: 143 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 14083
95 % 3 7 13685
90 % 3 7 13513
70 % 3 7 12791
50 % 67 192 250
40 % 71 200 247
30 % 71 201 261
Entity #44 | Chains: Ck
40S ribosomal protein S11-like protein protein, length: 161 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 5 19176
95 % 2 5 18189
90 % 2 5 17863
70 % 51 95 449
50 % 67 198 240
40 % 67 198 249
30 % 67 198 264
Entity #45 | Chains: Cm
40S ribosomal protein S22-like protein protein, length: 130 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 14084
95 % 3 7 13198
90 % 3 7 13514
70 % 67 202 231
50 % 74 213 221
40 % 74 213 231
30 % 471 809 22
Entity #46 | Chains: Cn
40S ribosomal protein s23-like protein protein, length: 145 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 14135
95 % 3 7 13255
90 % 3 7 13112
70 % 68 205 222
50 % 72 215 217
40 % 72 215 228
30 % 72 215 237
Entity #47 | Chains: Co
40S ribosomal protein S24 protein, length: 136 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 5 20865
95 % 2 5 18914
90 % 2 5 18557
70 % 2 5 17225
50 % 64 193 263
40 % 64 193 277
30 % 64 193 291
Entity #48 | Chains: Cp
40S ribosomal protein S28-like protein protein, length: 68 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13827
95 % 3 7 13170
90 % 3 7 13010
70 % 67 193 246
50 % 73 204 228
40 % 73 205 239
30 % 73 205 251
Entity #49 | Chains: CU
Faf1 protein, length: 311 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 14232
95 % 3 7 14005
90 % 3 7 13819
70 % 3 7 13069
50 % 3 7 11919
40 % 3 7 11209
30 % 3 7 10340
Entity #5 | Chains: UF
Utp6 protein, length: 414 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 14266
95 % 3 7 13783
90 % 3 7 13878
70 % 3 7 13122
50 % 3 7 11977
40 % 3 7 11030
30 % 3 7 10185
Entity #50 | Chains: C1
35S ribosomal RNA rna, length: 2352 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
Entity #51 | Chains: C2
U3 snoRNA rna, length: 230 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
Entity #52 | Chains: UV
U3 small nucleolar RNA-associated protein 22 protein, length: 1171 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 4 24737
95 % 1 4 24586
90 % 1 4 23793
70 % 1 4 21765
50 % 1 4 19197
40 % 1 4 17637
30 % 1 4 15892
Entity #53 | Chains: CV
Rrp7 protein, length: 322 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 4 26538
95 % 1 4 23117
90 % 1 4 22428
70 % 1 4 23737
50 % 1 4 18246
40 % 1 4 18933
30 % 1 4 17101
Entity #54 | Chains: CW
Ribosome biogenesis protein ENP2 protein, length: 668 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 4 31728
95 % 2 4 27008
90 % 2 4 26110
70 % 2 4 23736
50 % 2 4 20836
40 % 2 4 19071
30 % 2 4 17100
Entity #55 | Chains: UT
Utp20 protein, length: 2612 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 4 29721
95 % 2 4 23662
90 % 2 4 23362
70 % 2 4 21396
50 % 2 4 18901
40 % 2 4 17104
30 % 2 4 15440
Entity #56 | Chains: UH
Utp8 protein, length: 930 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 6 18738
95 % 3 6 17478
90 % 3 6 15858
70 % 3 6 15975
50 % 3 6 14410
40 % 3 6 13383
30 % 3 6 12235
Entity #57 | Chains: UE,UI
Utp5 protein, length: 410 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 6 7195
95 % 3 6 7659
90 % 3 6 7183
70 % 3 6 7071
50 % 3 6 7106
40 % 3 6 6875
30 % 3 6 6195
Entity #58 | Chains: US
Noc4 protein, length: 549 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 6 18737
95 % 3 6 16147
90 % 3 6 17165
70 % 3 6 15974
50 % 3 6 14409
40 % 3 6 13382
30 % 3 6 12234
Entity #59 | Chains: Cl
Rps18 protein, length: 156 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 6 17791
95 % 3 6 16082
90 % 3 6 15793
70 % 67 185 252
50 % 69 194 246
40 % 73 204 241
30 % 73 204 252
Entity #6 | Chains: UG
Utp7 protein, length: 558 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13797
95 % 3 7 13950
90 % 3 7 13765
70 % 3 7 13012
50 % 3 7 11866
40 % 3 9 8482
30 % 3 9 7940
Entity #60 | Chains: CX
Enp1 protein, length: 480 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 6 17790
95 % 3 6 16081
90 % 3 6 15792
70 % 3 6 14806
50 % 3 6 13412
40 % 3 6 12490
30 % 4 15 5128
Entity #61 | Chains: CY
U3 small nucleolar ribonucleoprotein protein lcp5-like protein protein, length: 381 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 3 36662
95 % 2 3 28882
90 % 2 3 27875
70 % 2 3 25217
50 % 2 3 21481
40 % 2 3 20190
30 % 2 3 18077
Entity #62 | Chains: CZ
Bfr2 protein, length: 609 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 4 29722
95 % 2 4 24128
90 % 2 4 23363
70 % 2 4 21018
50 % 2 4 18902
40 % 2 4 17370
30 % 2 4 15662
Entity #63 | Chains: UP
Utp16 protein, length: 364 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 6 17367
95 % 3 6 14789
90 % 3 6 15165
70 % 3 6 14265
50 % 3 6 12960
40 % 3 6 12101
30 % 3 6 11139
Entity #7 | Chains: UJ
UTP10 protein, length: 1802 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 8 12648
95 % 3 8 12244
90 % 3 8 11875
70 % 3 8 11242
50 % 3 8 10474
40 % 3 8 9828
30 % 3 8 9198
Entity #8 | Chains: UK
U3 small nucleolar RNA-associated protein 11 protein, length: 270 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13879
95 % 3 7 13270
90 % 3 7 13127
70 % 3 7 12424
50 % 3 7 11345
40 % 3 7 10672
30 % 3 7 9852
Entity #9 | Chains: UL
Utp12 protein, length: 962 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13641
95 % 3 7 13105
90 % 3 7 13766
70 % 3 7 12277
50 % 3 7 11867
40 % 3 11 7314
30 % 3 11 6877

Instructions

In the table for each entity, view a list of similar sequences by selecting the link associated with the percentage cutoff.



View more detailed documentation on the redundancy reduction and sequence clustering procedure used by RCSB PDB.

You can also use the structure comparison tool to compare any 2 given structures


ACTION - (A) Select for download / view details OR (B) Select two chains for comparison
Rank PDB ID Entity ID Chains Description Details Taxonomy EC Number
1 4V88 16 AO, CO 40S ribosomal protein S14-A 4932
2 4U4R 16 C4, c4 40S ribosomal protein S14-A 4932
3 4U3U 16 C4, c4 40S ribosomal protein S14-A 4932
4 5TBW 63 P, c4 40S ribosomal protein S14-B 4932
5 4U3M 16 C4, c4 40S ribosomal protein S14-A 4932
6 4U3N 16 C4, c4 40S ribosomal protein S14-A 4932
7 4U52 16 C4, c4 40S ribosomal protein S14-A 4932
8 4U4Q 16 C4, c4 40S ribosomal protein S14-A 4932
9 4U6F 16 C4, c4 40S ribosomal protein S14-A 4932
10 4U4U 16 C4, c4 40S ribosomal protein S14-A 4932
11 4U4Z 16 C4, c4 40S ribosomal protein S14-A 4932
12 4U4Y 16 C4, c4 40S ribosomal protein S14-A 4932
13 4U4N 16 C4, c4 40S ribosomal protein S14-A 4932
14 4U55 16 C4, c4 40S ribosomal protein S14-A 4932
15 5DAT 16 C4, c4 40S ribosomal protein S14-A 4932
16 5I4L 16 C4, c4 40S ribosomal protein S14-B 4932
17 4U51 16 C4, c4 40S ribosomal protein S14-A 4932
18 6HHQ 62 P, c4 40S ribosomal protein S14-B 4932
19 5OBM 60 C4, c4 40S ribosomal protein S14-B 4932
20 4U53 16 C4, c4 40S ribosomal protein S14-A 4932
21 5ON6 64 P, c4 40S ribosomal protein S14-B 4932
22 4U50 16 C4, c4 40S ribosomal protein S14-A 4932
23 5NDV 60 C4, c4 40S ribosomal protein S14-B 4932
24 5LYB 16 C4, c4 40S Ribosomal Protein S14 4932
25 4U56 16 C4, c4 40S ribosomal protein S14-A 4932
26 5TGA 16 C4, c4 40S ribosomal protein S14-B 4932
27 5MEI 63 P, c4 40S ribosomal protein S14-B 4932
28 5FCJ 16 C4, c4 40S ribosomal protein S14-A (UNK) residues correspond to residues that aren't well resolved, and for which side-chains could not be modeled. (UNK)s were substituted in the original sequence of the crystallized protein. Remaining misalignments result from differences in the distribution of (UNK)s between the two instances of the molecule in the structure. Here is the original sequence ot the crystallized protein : SNVVQARDNSQVFGVARIYASFNDTFVHVTDLSGKETIARVTGGMKVKADRDESSPYAAMLAAQDVAAKCKEVGITAVHV KIRATGGTRTKTPGPGGQAALRALARSGLRIGRIEDVTPVPSDSTRKKGGRRGRRL 4932
29 4U4O 16 C4, c4 40S ribosomal protein S14-A 4932
30 5DGV 16 C4, c4 40S ribosomal protein S14-A 4932
31 5DGE 16 C4, c4 40S ribosomal protein S14-A 4932
32 5NDW 9 C4, c4 40S ribosomal protein S14-B 4932
33 4BTS 21 AK, BK, CK, DK 40S RIBOSOMAL PROTEIN RPS14E 5911
34 5NDG 16 C4, c4 40S ribosomal protein S14-A 4932
35 5FCI 16 C4, c4 40S ribosomal protein S14-A (UNK) residues correspond to residues that aren't well resolved, and for which side-chains could not be modeled. (UNK)s were substituted in the original sequence of the crystallized protein. Remaining misalignments result from differences in the distribution of (UNK)s between the two instances of the molecule in the structure. Here is the original sequence ot the crystallized protein : SNVVQARDNSQVFGVARIYASFNDTFVHVTDLSGKETIARVTGGMKVKADRDESSPYAAMLAAQDVAAKCKEVGITAVHV KIRATGGTRTKTPGPGGQAALRALARSGLRIGRIEDVTPVPSDSTRKKGGRRGRRL 4932
36 5DC3 16 C4, c4 40S ribosomal protein S14-A 4932
37 5DGF 16 C4, c4 40S ribosomal protein S14-A 4932
38 4V5O 20 AK, BK RPS14E 5911
39 5TGM 16 C4, c4 40S ribosomal protein S14-A 4932
40 4V7R 9 AH, CH 40S ribosomal protein S14-A 4932
41 5VYC 15 O1, O2, O3, O4, O5, O6 40S ribosomal protein S14 9606
42 4KZZ 15 O 40S Ribosomal Protein S14 9986
43 4KZX 15 O 40S ribosomal protein S14 9986
44 4KZY 15 O 40S Ribosomal Protein S14 9986
45 6ZOJ 16 O 40S ribosomal protein S14 9606
46 6YAL 17 Q 40S ribosomal protein uS11 9986
47 6YAM 17 Q 40S ribosomal protein uS11 9986
48 6YAN 16 Q 40S ribosomal protein uS11 9986
49 6W2S 13 P uS11 9986
50 6W2T 12 P uS11 9986
51 6Y7C 14 O 40S ribosomal protein S14-A 4932
52 6Y57 63 SO 40S ribosomal protein S14 9606
53 6Y2L 63 SO 40S ribosomal protein S14 9606
54 6Y0G 64 SO 40S ribosomal protein S14 9606
55 6TNU 18 Z 40S ribosomal protein S14-B 4932
56 6UZ7 62 O 40S ribosomal protein S14 28985
57 6TB3 18 Z 40S ribosomal protein S14-B 4932
58 6T83 17 Ob, p 40S ribosomal protein S14-A 4932
59 6T7T 19 SO 40S ribosomal protein S14-B 4932
60 6T7I 17 SO 40S ribosomal protein S14-A 4932
61 6T4Q 16 SO 40S ribosomal protein S14-B 4932
62 6SV4 33 Z, Zb, Zc 40S ribosomal protein S14-A 4932
63 6SNT 17 O 40S ribosomal protein S14-A 4932
64 6SGC 16 P1 uS11 9986
65 6S47 60 BP 40S ribosomal protein S14-A 4932
66 6RXT 39 Ci 40S ribosomal protein S14-like protein 209285
67 6RXU 42 Ci 40S ribosomal protein S14-like protein 209285
68 6RXV 42 Ci 40S ribosomal protein S14-like protein 209285
69 6RXX 24 Ci 40S ribosomal protein S14-like protein 209285
70 6RXY 38 Ci 40S ribosomal protein S14-like protein 209285
71 6RXZ 41 Ci 40S ribosomal protein S14-like protein 209285
72 6P5I 16 P uS11 9986
73 6P5J 16 P uS11 9986
74 6P5K 62 P uS11 9986
75 6P5N 62 P uS11 9986
76 6P4G 16 P uS11 9986
77 6P4H 17 P uS11 9986
78 6OM7 28 SO 40S ribosomal protein S14 9606
79 6OLZ 61 BO 40S ribosomal protein S14 9606
80 6OM0 28 SO 40S ribosomal protein S14 9606
81 6OLE 28 SO 40S ribosomal protein S14 9606
82 6OLF 28 SO 40S ribosomal protein S14 9606
83 6OLG 64 BO 40S ribosomal protein S14 9606
84 6OLI 28 SO 40S ribosomal protein S14 9606
85 6OKK 16 P 40S ribosomal protein S11 5833
86 6RBD 27 O 40S ribosomal protein S14-A 4932
87 6RBE 12 O 40S ribosomal protein S14-A 4932
88 6R7Q 13 MM uS11 9986
89 6R6G 36 MM 40S ribosomal protein S14 9986
90 6R6P 62 MM uS11 9986
91 6R5Q 66 MM uS11 9986
92 6QZP 75 SO 40S ribosomal protein S14 9606
93 6Q8Y 81 Z 40S ribosomal protein S14-B 4932
94 6I7O 33 Z, Zb 40S ribosomal protein S14-B 4932
95 6IP5 74 3L 40S ribosomal protein S14 9606
96 6IP6 73 3L 40S ribosomal protein S14 9606
97 6IP8 73 3L 40S ribosomal protein S14 9606
98 6MTB 65 OO 40S ribosomal protein S14 9986
99 6MTC 64 OO 40S ribosomal protein S14 9986
100 6MTD 66 OO uS11 9986
101 6MTE 65 OO uS11 9986
102 6HCQ 19 P2 uS11 9986
103 6HCJ 19 P2 uS11 9986
104 6HCM 16 P1 uS11 9986
105 6HCF 16 P1 uS11 9986
106 6GZ3 31 BO ribosomal protein uS11 9986
107 6GZ4 34 BO ribosomal protein uS11 9986
108 6GZ5 31 BO ribosomal protein uS11 9986
109 6GSM 18 O 40S ribosomal protein S14 28985
110 6GSN 38 O 40S ribosomal protein S14 28985
111 6GQV 62 AE 40S ribosomal protein S14-B 4932
112 6GQ1 62 AE 40S ribosomal protein S14-B 4932
113 6GQB 62 AE 40S ribosomal protein S14-B 4932
114 6D9J 64 PP uS11 9986
115 6D90 65 PP uS11 9986
116 6G5H 12 O 40S ribosomal protein S14 9606
117 6G5I 16 O 40S ribosomal protein S14 9606
118 6G4S 27 O 40S ribosomal protein S14 9606
119 6G4W 23 O 40S ribosomal protein S14 9606
120 6G51 13 O 40S ribosomal protein S14 9606
121 6G53 13 O 40S ribosomal protein S14 9606
122 6G18 23 O 40S ribosomal protein S14 9606
123 6FYX 18 O 40S ribosomal protein S14 28985
124 6FYY 18 O 40S ribosomal protein S14 28985
125 6FEC 38 j 40S ribosomal protein S14 9606
126 6FAI 25 O 40S ribosomal protein S14-A 4932
127 6EML 22 Z 40S ribosomal protein S14-A 4932
128 6EK0 75 SO 40S ribosomal protein S14 9606
129 6AZ1 15 O ribosomal protein S11 5661
130 5OQL 42 t 40S ribosomal protein S14-like protein 209285
131 5OPT 14 V 40S ribosomal protein S14, putative 5693
132 5WLC 40 NG rpS14_uS11 4932
133 5XYI 16 O Ribosomal protein S14 5722
134 5XXU 16 O Ribosomal protein uS11 5811
135 5OA3 19 O 40S ribosomal protein S14 9606
136 5WYJ 45 SP 40S ribosomal protein S14-A 4932
137 5WYK 41 SP 40S ribosomal protein S14-A 4932
138 5MC6 27 Z 40S ribosomal protein S14-A 4932
139 5M1J 22 O2 40S ribosomal protein S14-A 4932
140 5LZS 65 OO uS11 9986
141 5LZT 66 OO uS11 9986
142 5LZU 65 OO uS11 9986
143 5LZV 66 OO uS11 9986
144 5LZW 66 OO uS11 9986
145 5LZX 66 OO uS11 9986
146 5LZY 64 OO uS11 9986
147 5LZZ 66 OO uS11 9986
148 5T2A 63 AH uS11 5661
149 5T2C 80 AO 40S ribosomal protein S14 9606
150 5LL6 12 Z 40S ribosomal protein S14-A 4932
151 5LKS 74 SO 40S ribosomal protein S14 9606
152 5K0Y 32 j ribosomal protein uS11 9986
153 5JUO 64 LB uS11 (yeast S14) 4932
154 5JUP 64 LB uS11 (yeast S14) 4932
155 5JUS 64 LB uS11 (yeast S14) 4932
156 5JUT 64 LB uS11 (yeast S14) 4932
157 5JUU 64 LB uS11 (yeast S14) 4932
158 5JPQ 29 w uS11 209285
159 5IT7 62 O 40S ribosomal protein S14 28985
160 5IT9 15 O Ribosomal protein uS14 28985
161 5FLX 16 O 40S RIBOSOMAL PROTEIN S14 9986
162 3JAP 18 O uS11 28985
163 3JAQ 18 O uS11 28985
164 3JAM 16 O uS11 28985
165 3JAN 64 SO Ribosomal protein uS11 SEE REMARK 999 9986
166 3JAJ 65 SO Ribosomal protein uS11 SEE REMARK 999 9986
167 3JAG 66 OO uS11 9986
168 3JAH 66 OO uS11 9986
169 3JAI 66 OO uS11 9986
170 5A2Q 17 O RIBOSOMAL PROTEIN US11 9606
171 4UG0 76 SO 40S RIBOSOMAL PROTEIN S14 9606
172 5AJ0 64 BO 40S ribosomal protein S14 9606
173 4UER 21 K US11 4934
174 4D61 16 O 40S RIBOSOMAL PROTEIN S14 9986
175 4D5L 16 O 40S RIBOSOMAL PROTEIN US11 9986
176 3J81 16 O uS11 28985
177 3J80 12 O uS11 28985
178 3J7P 64 SO Ribosomal protein uS11 9823
179 3J7R 65 SO Ribosomal protein uS11 9823
180 4UJC 65 CO 40S RIBOSOMAL PROTEIN US11 9986
181 4UJD 65 CO 40S RIBOSOMAL PROTEIN ES11 9986
182 3J7A 16 P 40S ribosomal protein uS11 5833
183 3J77 60 14 40S ribosomal protein S14 4932
184 3J78 60 14 40S ribosomal protein S14 4932
185 3J6X 61 14 40S ribosomal protein S14 4932
186 3J6Y 61 14 40S ribosomal protein S14 4932
187 4UJE 19 BO 40S RIBOSOMAL PROTEIN S14 9986
188 4V92 17 BO US11 28985
189 4V7E 16 BO 40S ribosomal protein S11 4565
190 4V8Y 23 AO 40S RIBOSOMAL PROTEIN S14-A 4932
191 4V8Z 23 AO 40S RIBOSOMAL PROTEIN S14-A 4932
192 4V6W 5 AO 40S ribosomal protein S14 7227
193 4V6X 5 AO 40S ribosomal protein S14 9606
194 4V8M 16 AH 40S RIBOSOMAL PROTEIN S14 185431
195 3J0O 12 K Ribosomal protein S14 9986
196 3J0L 12 K Ribosomal protein S14 9986
197 4V6I 12 AK 40S ribosomal protein rpS14 (S11p) 4932
198 4V7H 10 AK 40S ribosomal protein S14(A) 5541
199 4V5Z 18 Ak 40S Ribosomal protein S14e 9612
200 4V4B 11 AK 40S ribosomal protein S14-A 4932