6RXV

Cryo-EM structure of the 90S pre-ribosome (Kre33-Noc4) from Chaetomium thermophilum, state B2


Sequence Similarity Clusters for the Entities in PDB 6RXV

Entity #1 | Chains: UA
Periodic tryptophan protein 2-like protein protein, length: 904 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13668
95 % 3 7 13498
90 % 3 7 13330
70 % 3 7 12636
50 % 3 11 7489
40 % 3 11 7221
30 % 3 11 6777
Entity #10 | Chains: UM
Utp13 protein, length: 912 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 12758
95 % 3 7 12565
90 % 3 7 12384
70 % 3 7 11793
50 % 3 7 10756
40 % 3 7 10327
30 % 3 7 9547
Entity #11 | Chains: UN
Utp14 protein, length: 938 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 12714
95 % 3 7 12731
90 % 3 7 12557
70 % 3 7 11940
50 % 3 7 10889
40 % 3 7 10256
30 % 3 7 9482
Entity #12 | Chains: UO
Utp15 protein, length: 557 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13177
95 % 3 7 12554
90 % 3 7 12565
70 % 3 7 11946
50 % 3 7 10740
40 % 3 7 10116
30 % 3 9 7945
Entity #13 | Chains: UQ
Utp17 protein, length: 960 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13696
95 % 3 7 13549
90 % 3 7 13373
70 % 3 7 12681
50 % 3 7 11577
40 % 3 7 10721
30 % 3 7 9895
Entity #14 | Chains: UR
Utp18 protein, length: 618 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 12713
95 % 3 7 12730
90 % 3 7 12556
70 % 3 7 11939
50 % 3 7 10888
40 % 3 7 10255
30 % 3 11 6661
Entity #15 | Chains: UU
Utp21 protein, length: 1049 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13496
95 % 3 7 13160
90 % 3 7 13006
70 % 3 7 12321
50 % 3 7 11236
40 % 3 7 10588
30 % 3 7 9778
Entity #16 | Chains: UX
Utp24 protein, length: 193 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 8 12208
95 % 3 8 11623
90 % 3 8 11474
70 % 3 8 11000
50 % 3 12 6976
40 % 3 12 6726
30 % 3 12 6336
Entity #17 | Chains: UZ
Utp30 protein, length: 391 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 12864
95 % 3 7 12528
90 % 3 7 12855
70 % 3 7 12498
50 % 3 7 11415
40 % 3 7 10475
30 % 3 7 9683
Entity #18 | Chains: CA,CB
Nop1 protein, length: 313 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 5463
95 % 3 7 6274
90 % 3 7 6288
70 % 3 7 6205
50 % 3 11 3538
40 % 3 11 3519
30 % 3 11 3445
Entity #19 | Chains: CC
Nop56 protein, length: 523 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13028
95 % 3 7 13313
90 % 3 7 12867
70 % 3 7 12463
50 % 3 11 7499
40 % 3 15 5379
30 % 3 15 5135
Entity #2 | Chains: UB
Utp2 protein, length: 907 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13487
95 % 3 7 13145
90 % 3 7 12994
70 % 3 7 12308
50 % 3 7 11222
40 % 3 7 10574
30 % 3 7 9765
Entity #20 | Chains: CD
Nop58 protein, length: 582 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13675
95 % 3 7 13504
90 % 3 7 13334
70 % 3 7 12643
50 % 3 7 11544
40 % 3 7 10865
30 % 3 7 10029
Entity #21 | Chains: CE,CF
Snu13 protein, length: 127 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 5451
95 % 3 7 6257
90 % 3 7 6273
70 % 3 7 5980
50 % 12 34 1358
40 % 13 35 1351
30 % 12 34 1438
Entity #22 | Chains: CG
Rrp9 protein, length: 630 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13305
95 % 3 7 13105
90 % 3 7 12977
70 % 3 7 12265
50 % 3 7 10949
40 % 3 7 10525
30 % 3 7 9728
Entity #23 | Chains: CH
RNA 3'-terminal phosphate cyclase-like protein protein, length: 411 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13458
95 % 3 7 13106
90 % 3 7 12948
70 % 3 7 12266
50 % 3 7 11183
40 % 3 7 10526
30 % 3 7 9729
Entity #24 | Chains: CI
Bms1 protein, length: 1163 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13074
95 % 3 7 13414
90 % 3 7 13244
70 % 3 7 12553
50 % 3 7 11460
40 % 3 11 7226
30 % 3 11 6780
Entity #25 | Chains: CJ
Imp3 protein, length: 183 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 8 10711
95 % 3 8 11881
90 % 3 8 11737
70 % 3 8 11210
50 % 3 12 6918
40 % 3 12 6667
30 % 3 12 6294
Entity #26 | Chains: CK
Imp4 protein, length: 297 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 8 12140
95 % 3 8 11799
90 % 3 8 11667
70 % 3 8 9927
50 % 3 11 7321
40 % 3 11 7065
30 % 3 11 6630
Entity #27 | Chains: CL
Mpp10 protein, length: 785 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13674
95 % 3 7 13503
90 % 3 7 13333
70 % 3 7 12642
50 % 3 7 11543
40 % 3 7 10864
30 % 3 7 10028
Entity #28 | Chains: CM
Sof1 protein, length: 446 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 12740
95 % 3 7 13277
90 % 3 7 13114
70 % 3 7 12421
50 % 3 7 11341
40 % 3 9 8547
30 % 3 9 7978
Entity #29 | Chains: CN,CO
Emg1 protein, length: 252 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 5342
95 % 3 7 6048
90 % 3 7 6076
70 % 8 17 2342
50 % 8 17 2379
40 % 8 17 2440
30 % 8 17 2402
Entity #3 | Chains: UC
Utp3 protein, length: 648 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13317
95 % 3 7 12840
90 % 3 7 12661
70 % 3 7 12035
50 % 3 7 10969
40 % 3 7 10337
30 % 3 7 9555
Entity #30 | Chains: CP
KRR1 small subunit processome component protein, length: 322 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 8 8797
95 % 3 8 9399
90 % 3 8 9313
70 % 3 11 7530
50 % 3 11 6299
40 % 3 11 6119
30 % 3 11 5834
Entity #31 | Chains: CQ
Pre-rRNA-processing protein PNO1 protein, length: 259 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13663
95 % 3 7 13492
90 % 3 7 13323
70 % 3 7 12632
50 % 3 7 11532
40 % 3 7 10858
30 % 3 7 10021
Entity #32 | Chains: CR,CS
Kre33 protein, length: 1073 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 8 4429
95 % 3 8 5070
90 % 3 8 5130
70 % 3 8 5085
50 % 3 8 4928
40 % 3 8 5022
30 % 3 8 4657
Entity #33 | Chains: CT
Fcf2 protein, length: 203 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 12791
95 % 3 7 12887
90 % 3 7 12706
70 % 3 7 12084
50 % 3 7 11015
40 % 3 7 10379
30 % 3 7 9585
Entity #34 | Chains: Ca
40S ribosomal protein S1 protein, length: 255 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 5 18053
95 % 3 5 16957
90 % 3 5 16663
70 % 46 86 472
50 % 51 142 350
40 % 53 149 350
30 % 53 149 367
Entity #35 | Chains: Cb
40S ribosomal protein S4 protein, length: 264 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 5 18486
95 % 2 5 17636
90 % 2 5 17307
70 % 50 168 265
50 % 52 178 261
40 % 52 182 266
30 % 56 191 259
Entity #36 | Chains: Cc
40S ribosomal protein s5-like protein protein, length: 212 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13354
95 % 3 7 12910
90 % 3 7 12733
70 % 8 93 634
50 % 54 188 235
40 % 54 188 245
30 % 54 188 263
Entity #37 | Chains: Cd
40S ribosomal protein S6 protein, length: 239 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 5 20142
95 % 2 5 18446
90 % 2 5 18101
70 % 7 83 721
50 % 51 169 303
40 % 51 174 302
30 % 51 174 328
Entity #38 | Chains: Ce
40S ribosomal protein S7 protein, length: 203 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 12761
95 % 3 7 13322
90 % 3 7 13155
70 % 3 7 12029
50 % 51 175 285
40 % 51 175 299
30 % 53 178 300
Entity #39 | Chains: Cf
40S ribosomal protein S8 protein, length: 202 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 5 18485
95 % 2 5 17635
90 % 2 5 16728
70 % 45 88 463
50 % 52 177 264
40 % 52 181 267
30 % 52 181 289
Entity #4 | Chains: UD
Utp4 protein, length: 884 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 4 8 9635
95 % 4 8 10152
90 % 4 8 10065
70 % 4 8 9748
50 % 4 8 9074
40 % 4 8 8684
30 % 4 8 8107
Entity #40 | Chains: Cg
40S ribosomal protein s9-like protein protein, length: 190 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13321
95 % 3 7 12849
90 % 3 7 12670
70 % 52 172 258
50 % 54 187 237
40 % 58 195 237
30 % 58 195 251
Entity #41 | Chains: Ch
40S ribosomal protein S13-like protein protein, length: 151 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13353
95 % 3 7 12909
90 % 3 7 12732
70 % 52 177 250
50 % 54 184 246
40 % 58 192 241
30 % 58 193 254
Entity #42 | Chains: Ci
40S ribosomal protein S14-like protein protein, length: 150 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13511
95 % 3 7 13193
90 % 7 73 805
70 % 54 185 226
50 % 54 186 240
40 % 54 186 250
30 % 54 186 269
Entity #43 | Chains: Cj
40S ribosomal protein S16-like protein protein, length: 143 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13399
95 % 3 7 12992
90 % 3 7 12817
70 % 3 7 12172
50 % 54 179 255
40 % 58 187 249
30 % 58 188 264
Entity #44 | Chains: Ck
40S ribosomal protein S11-like protein protein, length: 161 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 5 18812
95 % 2 5 18447
90 % 2 5 18102
70 % 46 90 443
50 % 53 184 242
40 % 53 184 256
30 % 53 184 273
Entity #45 | Chains: Cm
40S ribosomal protein S22-like protein protein, length: 130 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13264
95 % 3 7 12614
90 % 3 7 13001
70 % 53 188 231
50 % 60 199 221
40 % 60 199 233
30 % 422 760 22
Entity #46 | Chains: Cn
40S ribosomal protein s23-like protein protein, length: 145 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13651
95 % 3 7 13481
90 % 3 7 13312
70 % 54 191 212
50 % 58 201 215
40 % 58 201 230
30 % 58 201 245
Entity #47 | Chains: Co
40S ribosomal protein S24 protein, length: 136 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 5 18852
95 % 2 5 18301
90 % 2 5 18054
70 % 45 90 451
50 % 50 179 271
40 % 50 179 283
30 % 50 179 308
Entity #48 | Chains: Cp
40S ribosomal protein S28-like protein protein, length: 68 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13265
95 % 3 7 12717
90 % 3 7 12543
70 % 52 178 248
50 % 58 189 234
40 % 58 190 244
30 % 58 190 258
Entity #49 | Chains: CU
Faf1 protein, length: 311 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13400
95 % 3 7 13215
90 % 3 7 12818
70 % 3 7 12173
50 % 3 7 11339
40 % 3 7 10448
30 % 3 7 9661
Entity #5 | Chains: UF
Utp6 protein, length: 414 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13204
95 % 3 7 12611
90 % 3 7 12427
70 % 3 7 11841
50 % 3 7 10791
40 % 3 7 10163
30 % 3 7 9399
Entity #50 | Chains: C1
35S ribosomal RNA rna, length: 2352 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
Entity #51 | Chains: C2
U3 snoRNA rna, length: 230 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
Entity #52 | Chains: UV
U3 small nucleolar RNA-associated protein 22 protein, length: 1171 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 4 30597
95 % 1 4 26083
90 % 1 4 25226
70 % 1 4 22965
50 % 1 4 20205
40 % 1 4 18511
30 % 1 4 16591
Entity #53 | Chains: CV
Rrp7 protein, length: 322 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 4 23820
95 % 1 4 25693
90 % 1 4 22989
70 % 1 4 21013
50 % 1 4 18605
40 % 1 4 17120
30 % 1 4 15430
Entity #54 | Chains: CW
Ribosome biogenesis protein ENP2 protein, length: 668 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 4 28642
95 % 2 4 23242
90 % 2 4 22546
70 % 2 4 20627
50 % 2 4 18299
40 % 2 4 16847
30 % 2 4 15188
Entity #55 | Chains: UT
Utp20 protein, length: 2612 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 4 23821
95 % 2 4 25696
90 % 2 4 22990
70 % 2 4 22658
50 % 2 4 19958
40 % 2 4 17121
30 % 2 4 15431
Entity #56 | Chains: UH
Utp8 protein, length: 930 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 6 15152
95 % 3 6 14525
90 % 3 6 15537
70 % 3 6 14625
50 % 3 6 13218
40 % 3 6 11556
30 % 3 6 11818
Entity #57 | Chains: UE,UI
Utp5 protein, length: 410 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 6 7171
95 % 3 6 7817
90 % 3 6 7747
70 % 3 6 7594
50 % 3 6 7136
40 % 3 6 6888
30 % 3 6 6466
Entity #58 | Chains: US
Noc4 protein, length: 549 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 6 17961
95 % 3 6 16809
90 % 3 6 16224
70 % 3 6 15458
50 % 3 6 14030
40 % 3 6 11949
30 % 3 6 10961
Entity #59 | Chains: Cl
Rps18 protein, length: 156 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 6 17036
95 % 3 6 14219
90 % 3 6 15168
70 % 52 170 260
50 % 54 179 258
40 % 58 188 247
30 % 58 189 260
Entity #6 | Chains: UG
Utp7 protein, length: 558 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13689
95 % 3 7 13540
90 % 3 7 13366
70 % 3 7 12675
50 % 3 7 11572
40 % 3 9 8172
30 % 3 9 7632
Entity #60 | Chains: CX
Enp1 protein, length: 480 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 6 17087
95 % 3 6 15456
90 % 3 6 15232
70 % 3 6 14339
50 % 3 6 12977
40 % 3 6 12127
30 % 3 14 5423
Entity #61 | Chains: CY
U3 small nucleolar ribonucleoprotein protein lcp5-like protein protein, length: 381 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 3 34993
95 % 2 3 27442
90 % 2 3 26472
70 % 2 3 24054
50 % 2 3 21122
40 % 2 3 19354
30 % 2 3 17340
Entity #62 | Chains: CZ
Bfr2 protein, length: 609 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 4 25762
95 % 2 4 19188
90 % 2 4 18797
70 % 2 4 17440
50 % 2 4 15681
40 % 2 4 14575
30 % 2 4 13242
Entity #63 | Chains: UP
Utp16 protein, length: 364 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 6 17037
95 % 3 6 14220
90 % 3 6 15169
70 % 3 6 14285
50 % 3 6 13062
40 % 3 6 12090
30 % 3 6 11089
Entity #7 | Chains: UJ
UTP10 protein, length: 1802 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 8 11560
95 % 3 8 10878
90 % 3 8 10780
70 % 3 8 10386
50 % 3 8 9607
40 % 3 8 9159
30 % 3 8 8520
Entity #8 | Chains: UK
U3 small nucleolar RNA-associated protein 11 protein, length: 270 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13667
95 % 3 7 13497
90 % 3 7 13329
70 % 3 7 12229
50 % 3 7 11535
40 % 3 7 10860
30 % 3 7 10024
Entity #9 | Chains: UL
Utp12 protein, length: 962 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 12715
95 % 3 7 12732
90 % 3 7 12558
70 % 3 7 11932
50 % 3 7 10890
40 % 3 11 6923
30 % 3 11 6589

Instructions

In the table for each entity, view a list of similar sequences by selecting the link associated with the percentage cutoff.



View more detailed documentation on the redundancy reduction and sequence clustering procedure used by RCSB PDB.

You can also use the structure comparison tool to compare any 2 given structures


ACTION - (A) Select for download / view details OR (B) Select two chains for comparison
Rank PDB ID Entity ID Chains Description Details Taxonomy EC Number
1 4V88 16 AO, CO 40S ribosomal protein S14-A 4932
2 4U4R 16 C4, c4 40S ribosomal protein S14-A 4932
3 4U3U 16 C4, c4 40S ribosomal protein S14-A 4932
4 5TBW 63 P, c4 40S ribosomal protein S14-B 4932
5 4U3M 16 C4, c4 40S ribosomal protein S14-A 4932
6 4U3N 16 C4, c4 40S ribosomal protein S14-A 4932
7 4U52 16 C4, c4 40S ribosomal protein S14-A 4932
8 4U4Q 16 C4, c4 40S ribosomal protein S14-A 4932
9 4U6F 16 C4, c4 40S ribosomal protein S14-A 4932
10 4U4U 16 C4, c4 40S ribosomal protein S14-A 4932
11 4U4Z 16 C4, c4 40S ribosomal protein S14-A 4932
12 4U4Y 16 C4, c4 40S ribosomal protein S14-A 4932
13 4U4N 16 C4, c4 40S ribosomal protein S14-A 4932
14 4U55 16 C4, c4 40S ribosomal protein S14-A 4932
15 5DAT 16 C4, c4 40S ribosomal protein S14-A 4932
16 5I4L 16 C4, c4 40S ribosomal protein S14-B 4932
17 4U51 16 C4, c4 40S ribosomal protein S14-A 4932
18 6HHQ 62 P, c4 40S ribosomal protein S14-B 4932
19 5OBM 60 C4, c4 40S ribosomal protein S14-B 4932
20 4U53 16 C4, c4 40S ribosomal protein S14-A 4932
21 5ON6 64 P, c4 40S ribosomal protein S14-B 4932
22 4U50 16 C4, c4 40S ribosomal protein S14-A 4932
23 5NDV 60 C4, c4 40S ribosomal protein S14-B 4932
24 5LYB 16 C4, c4 40S Ribosomal Protein S14 4932
25 4U56 16 C4, c4 40S ribosomal protein S14-A 4932
26 5TGA 16 C4, c4 40S ribosomal protein S14-B 4932
27 5MEI 63 P, c4 40S ribosomal protein S14-B 4932
28 5FCJ 16 C4, c4 40S ribosomal protein S14-A (UNK) residues correspond to residues that aren't well resolved, and for which side-chains could not be modeled. (UNK)s were substituted in the original sequence of the crystallized protein. Remaining misalignments result from differences in the distribution of (UNK)s between the two instances of the molecule in the structure. Here is the original sequence ot the crystallized protein : SNVVQARDNSQVFGVARIYASFNDTFVHVTDLSGKETIARVTGGMKVKADRDESSPYAAMLAAQDVAAKCKEVGITAVHV KIRATGGTRTKTPGPGGQAALRALARSGLRIGRIEDVTPVPSDSTRKKGGRRGRRL 4932
29 4U4O 16 C4, c4 40S ribosomal protein S14-A 4932
30 5DGV 16 C4, c4 40S ribosomal protein S14-A 4932
31 5DGE 16 C4, c4 40S ribosomal protein S14-A 4932
32 5NDW 9 C4, c4 40S ribosomal protein S14-B 4932
33 4BTS 21 AK, BK, CK, DK 40S RIBOSOMAL PROTEIN RPS14E 5911
34 5NDG 16 C4, c4 40S ribosomal protein S14-A 4932
35 5FCI 16 C4, c4 40S ribosomal protein S14-A (UNK) residues correspond to residues that aren't well resolved, and for which side-chains could not be modeled. (UNK)s were substituted in the original sequence of the crystallized protein. Remaining misalignments result from differences in the distribution of (UNK)s between the two instances of the molecule in the structure. Here is the original sequence ot the crystallized protein : SNVVQARDNSQVFGVARIYASFNDTFVHVTDLSGKETIARVTGGMKVKADRDESSPYAAMLAAQDVAAKCKEVGITAVHV KIRATGGTRTKTPGPGGQAALRALARSGLRIGRIEDVTPVPSDSTRKKGGRRGRRL 4932
36 5DC3 16 C4, c4 40S ribosomal protein S14-A 4932
37 5DGF 16 C4, c4 40S ribosomal protein S14-A 4932
38 4V5O 20 AK, BK RPS14E 5911
39 5TGM 16 C4, c4 40S ribosomal protein S14-A 4932
40 4V7R 9 AH, CH 40S ribosomal protein S14-A 4932
41 5VYC 15 O1, O2, O3, O4, O5, O6 40S ribosomal protein S14 9606
42 4KZZ 15 O 40S Ribosomal Protein S14 9986
43 4KZX 15 O 40S ribosomal protein S14 9986
44 4KZY 15 O 40S Ribosomal Protein S14 9986
45 6UZ7 62 O 40S ribosomal protein S14 28985
46 6T83 17 Ob, p 40S ribosomal protein S14-A 4932
47 6T7T 19 SO 40S ribosomal protein S14-B 4932
48 6T7I 17 SO 40S ribosomal protein S14-A 4932
49 6T4Q 16 SO 40S ribosomal protein S14-B 4932
50 6SGC 16 P1 uS11 9986
51 6S47 60 BP 40S ribosomal protein S14-A 4932
52 6RXT 39 Ci 40S ribosomal protein S14-like protein 209285
53 6RXU 42 Ci 40S ribosomal protein S14-like protein 209285
54 6RXV 42 Ci 40S ribosomal protein S14-like protein 209285
55 6RXX 24 Ci 40S ribosomal protein S14-like protein 209285
56 6RXY 38 Ci 40S ribosomal protein S14-like protein 209285
57 6RXZ 41 Ci 40S ribosomal protein S14-like protein 209285
58 6P5I 16 P uS11 9986
59 6P5J 16 P uS11 9986
60 6P5K 62 P uS11 9986
61 6P5N 62 P uS11 9986
62 6P4G 16 P uS11 9986
63 6P4H 17 P uS11 9986
64 6OM7 28 SO 40S ribosomal protein S14 9606
65 6OLZ 61 BO 40S ribosomal protein S14 9606
66 6OM0 28 SO 40S ribosomal protein S14 9606
67 6OLE 28 SO 40S ribosomal protein S14 9606
68 6OLF 28 SO 40S ribosomal protein S14 9606
69 6OLG 64 BO 40S ribosomal protein S14 9606
70 6OLI 28 SO 40S ribosomal protein S14 9606
71 6OKK 16 P 40S ribosomal protein S11 5833
72 6RBD 27 O 40S ribosomal protein S14-A 4932
73 6RBE 12 O 40S ribosomal protein S14-A 4932
74 6R7Q 13 MM uS11 9986
75 6R6G 36 MM 40S ribosomal protein S14 9986
76 6R6P 62 MM uS11 9986
77 6R5Q 66 MM uS11 9986
78 6QZP 75 SO 40S ribosomal protein S14 9606
79 6Q8Y 81 Z 40S ribosomal protein S14-B 4932
80 6I7O 33 Z, Zb 40S ribosomal protein S14-B 4932
81 6IP5 74 3L 40S ribosomal protein S14 9606
82 6IP6 73 3L 40S ribosomal protein S14 9606
83 6IP8 73 3L 40S ribosomal protein S14 9606
84 6MTB 65 OO 40S ribosomal protein S14 9986
85 6MTC 64 OO 40S ribosomal protein S14 9986
86 6MTD 66 OO uS11 9986
87 6MTE 65 OO uS11 9986
88 6HCQ 19 P2 uS11 9986
89 6HCJ 19 P2 uS11 9986
90 6HCM 16 P1 uS11 9986
91 6HCF 16 P1 uS11 9986
92 6GZ3 31 BO ribosomal protein uS11 9986
93 6GZ4 34 BO ribosomal protein uS11 9986
94 6GZ5 31 BO ribosomal protein uS11 9986
95 6GSM 18 O 40S ribosomal protein S14 28985
96 6GSN 38 O 40S ribosomal protein S14 28985
97 6GQV 62 AE 40S ribosomal protein S14-B 4932
98 6GQ1 62 AE 40S ribosomal protein S14-B 4932
99 6GQB 62 AE 40S ribosomal protein S14-B 4932
100 6D9J 64 PP uS11 9986
101 6D90 65 PP uS11 9986
102 6G5H 12 O 40S ribosomal protein S14 9606
103 6G5I 16 O 40S ribosomal protein S14 9606
104 6G4S 27 O 40S ribosomal protein S14 9606
105 6G4W 23 O 40S ribosomal protein S14 9606
106 6G51 13 O 40S ribosomal protein S14 9606
107 6G53 13 O 40S ribosomal protein S14 9606
108 6G18 23 O 40S ribosomal protein S14 9606
109 6FYX 18 O 40S ribosomal protein S14 28985
110 6FYY 18 O 40S ribosomal protein S14 28985
111 6FEC 38 j 40S ribosomal protein S14 9606
112 6FAI 25 O 40S ribosomal protein S14-A 4932
113 6EML 22 Z 40S ribosomal protein S14-A 4932
114 6EK0 75 SO 40S ribosomal protein S14 9606
115 6AZ1 15 O ribosomal protein S11 5661
116 5OQL 42 t 40S ribosomal protein S14-like protein 209285
117 5OPT 14 V 40S ribosomal protein S14, putative 5693
118 5WLC 40 NG rpS14_uS11 4932
119 5XYI 16 O Ribosomal protein S14 5722
120 5XXU 16 O Ribosomal protein uS11 5811
121 5OA3 19 O 40S ribosomal protein S14 9606
122 5WYJ 45 SP 40S ribosomal protein S14-A 4932
123 5WYK 41 SP 40S ribosomal protein S14-A 4932
124 5MC6 27 Z 40S ribosomal protein S14-A 4932
125 5M1J 22 O2 40S ribosomal protein S14-A 4932
126 5LZS 65 OO uS11 9986
127 5LZT 66 OO uS11 9986
128 5LZU 65 OO uS11 9986
129 5LZV 66 OO uS11 9986
130 5LZW 66 OO uS11 9986
131 5LZX 66 OO uS11 9986
132 5LZY 64 OO uS11 9986
133 5LZZ 66 OO uS11 9986
134 5T2A 63 AH uS11 5661
135 5T2C 80 AO 40S ribosomal protein S14 9606
136 5LL6 12 Z 40S ribosomal protein S14-A 4932
137 5LKS 74 SO 40S ribosomal protein S14 9606
138 5K0Y 32 j ribosomal protein uS11 9986
139 5JUO 64 LB uS11 (yeast S14) 4932
140 5JUP 64 LB uS11 (yeast S14) 4932
141 5JUS 64 LB uS11 (yeast S14) 4932
142 5JUT 64 LB uS11 (yeast S14) 4932
143 5JUU 64 LB uS11 (yeast S14) 4932
144 5JPQ 29 w uS11 209285
145 5IT7 62 O 40S ribosomal protein S14 28985
146 5IT9 15 O Ribosomal protein uS14 28985
147 5FLX 16 O 40S RIBOSOMAL PROTEIN S14 9986
148 3JAP 18 O uS11 28985
149 3JAQ 18 O uS11 28985
150 3JAM 16 O uS11 28985
151 3JAN 64 SO Ribosomal protein uS11 SEE REMARK 999 9986
152 3JAJ 65 SO Ribosomal protein uS11 SEE REMARK 999 9986
153 3JAG 66 OO uS11 9986
154 3JAH 66 OO uS11 9986
155 3JAI 66 OO uS11 9986
156 5A2Q 17 O RIBOSOMAL PROTEIN US11 9606
157 4UG0 76 SO 40S RIBOSOMAL PROTEIN S14 9606
158 5AJ0 64 BO 40S ribosomal protein S14 9606
159 4UER 21 K US11 4934
160 4D61 16 O 40S RIBOSOMAL PROTEIN S14 9986
161 4D5L 16 O 40S RIBOSOMAL PROTEIN US11 9986
162 3J81 16 O uS11 28985
163 3J80 12 O uS11 28985
164 3J7P 64 SO Ribosomal protein uS11 9823
165 3J7R 65 SO Ribosomal protein uS11 9823
166 4UJC 65 CO 40S RIBOSOMAL PROTEIN US11 9986
167 4UJD 65 CO 40S RIBOSOMAL PROTEIN ES11 9986
168 3J7A 16 P 40S ribosomal protein uS11 5833
169 3J77 60 14 40S ribosomal protein S14 4932
170 3J78 60 14 40S ribosomal protein S14 4932
171 3J6X 61 14 40S ribosomal protein S14 4932
172 3J6Y 61 14 40S ribosomal protein S14 4932
173 4UJE 19 BO 40S RIBOSOMAL PROTEIN S14 9986
174 4V92 17 BO US11 28985
175 4V7E 16 BO 40S ribosomal protein S11 4565
176 4V8Y 23 AO 40S RIBOSOMAL PROTEIN S14-A 4932
177 4V8Z 23 AO 40S RIBOSOMAL PROTEIN S14-A 4932
178 4V6W 5 AO 40S ribosomal protein S14 7227
179 4V6X 5 AO 40S ribosomal protein S14 9606
180 4V8M 16 AH 40S RIBOSOMAL PROTEIN S14 185431
181 3J0O 12 K Ribosomal protein S14 9986
182 3J0L 12 K Ribosomal protein S14 9986
183 4V6I 12 AK 40S ribosomal protein rpS14 (S11p) 4932
184 4V7H 10 AK 40S ribosomal protein S14(A) 5541
185 4V5Z 18 Ak 40S Ribosomal protein S14e 9612
186 4V4B 11 AK 40S ribosomal protein S14-A 4932