Cryo-EM structure of the 90S pre-ribosome (Kre33-Noc4) from Chaetomium thermophilum, state B2

Sequence Similarity Clusters for the Entities in PDB 6RXV

Entity #1 | Chains: UA
Periodic tryptophan protein 2-like protein protein, length: 904 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13440
95 % 3 7 13263
90 % 3 7 13078
70 % 3 7 12428
50 % 3 11 7367
40 % 3 11 7117
30 % 3 11 6681
Entity #10 | Chains: UM
Utp13 protein, length: 912 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 12779
95 % 3 7 13038
90 % 3 7 12852
70 % 3 7 12212
50 % 3 7 11162
40 % 3 7 10515
30 % 3 7 9725
Entity #11 | Chains: UN
Utp14 protein, length: 938 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13143
95 % 3 7 12337
90 % 3 7 12384
70 % 3 7 11787
50 % 3 7 10760
40 % 3 7 10133
30 % 3 7 9213
Entity #12 | Chains: UO
Utp15 protein, length: 557 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 12780
95 % 3 7 13039
90 % 3 7 12853
70 % 3 7 12213
50 % 3 7 11163
40 % 3 7 10516
30 % 3 9 7685
Entity #13 | Chains: UQ
Utp17 protein, length: 960 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 12489
95 % 3 7 12301
90 % 3 7 13119
70 % 3 7 11537
50 % 3 7 10535
40 % 3 7 9924
30 % 3 7 9197
Entity #14 | Chains: UR
Utp18 protein, length: 618 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 12995
95 % 3 7 12438
90 % 3 7 12270
70 % 3 7 11685
50 % 3 7 10666
40 % 3 7 10044
30 % 3 11 6468
Entity #15 | Chains: UU
Utp21 protein, length: 1049 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 12925
95 % 3 7 12300
90 % 3 7 12117
70 % 3 7 11536
50 % 3 7 10534
40 % 3 7 9923
30 % 3 7 9196
Entity #16 | Chains: UX
Utp24 protein, length: 193 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 8 11993
95 % 3 8 10562
90 % 3 8 11189
70 % 3 8 10816
50 % 3 12 6772
40 % 3 12 6082
30 % 3 12 6002
Entity #17 | Chains: UZ
Utp30 protein, length: 391 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 12395
95 % 3 7 12315
90 % 3 7 12133
70 % 3 7 11559
50 % 3 7 10553
40 % 3 7 9941
30 % 3 7 9214
Entity #18 | Chains: CA,CB
Nop1 protein, length: 313 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 5352
95 % 3 7 6145
90 % 3 7 6171
70 % 3 7 6092
50 % 3 11 3459
40 % 3 11 3447
30 % 3 11 3375
Entity #19 | Chains: CC
Nop56 protein, length: 523 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13231
95 % 3 7 12876
90 % 3 7 12709
70 % 3 7 12079
50 % 3 11 7370
40 % 3 15 5279
30 % 3 15 5054
Entity #2 | Chains: UB
Utp2 protein, length: 907 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 12947
95 % 3 7 12786
90 % 3 7 12172
70 % 3 7 11600
50 % 3 7 10588
40 % 3 7 9969
30 % 3 7 9238
Entity #20 | Chains: CD
Nop58 protein, length: 582 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 12755
95 % 3 7 12533
90 % 3 7 13009
70 % 3 7 11772
50 % 3 7 11125
40 % 3 7 10488
30 % 3 7 9697
Entity #21 | Chains: CE,CF
Snu13 protein, length: 127 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 5351
95 % 3 7 6144
90 % 3 7 6170
70 % 3 7 6091
50 % 12 34 1326
40 % 13 35 1306
30 % 12 34 1398
Entity #22 | Chains: CG
Rrp9 protein, length: 630 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13419
95 % 3 7 13230
90 % 3 7 13046
70 % 3 7 12397
50 % 3 7 11332
40 % 3 7 10664
30 % 3 7 9861
Entity #23 | Chains: CH
RNA 3'-terminal phosphate cyclase-like protein protein, length: 411 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13273
95 % 3 7 12953
90 % 3 7 12780
70 % 3 7 12137
50 % 3 7 11094
40 % 3 7 10460
30 % 3 7 9671
Entity #24 | Chains: CI
Bms1 protein, length: 1163 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 12756
95 % 3 7 12997
90 % 3 7 12810
70 % 3 7 12173
50 % 3 7 11126
40 % 3 11 7111
30 % 3 11 6675
Entity #25 | Chains: CJ
Imp3 protein, length: 183 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 8 10166
95 % 3 8 11078
90 % 3 8 10914
70 % 3 8 10566
50 % 3 12 6582
40 % 3 12 6373
30 % 3 12 6040
Entity #26 | Chains: CK
Imp4 protein, length: 297 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 8 10028
95 % 3 8 10843
90 % 3 8 10701
70 % 3 8 10352
50 % 3 11 7357
40 % 3 11 7107
30 % 3 11 6673
Entity #27 | Chains: CL
Mpp10 protein, length: 785 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 12405
95 % 3 7 12952
90 % 3 7 12284
70 % 3 7 11539
50 % 3 7 11093
40 % 3 7 10459
30 % 3 7 9670
Entity #28 | Chains: CM
Sof1 protein, length: 446 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13274
95 % 3 7 12331
90 % 3 7 12781
70 % 3 7 11577
50 % 3 7 11095
40 % 3 9 7972
30 % 3 9 7456
Entity #29 | Chains: CN,CO
Emg1 protein, length: 252 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 5105
95 % 3 7 6096
90 % 3 7 5738
70 % 8 17 2249
50 % 8 17 2337
40 % 8 17 2367
30 % 8 17 2358
Entity #3 | Chains: UC
Utp3 protein, length: 648 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13414
95 % 3 7 13222
90 % 3 7 13040
70 % 3 7 12389
50 % 3 7 11323
40 % 3 7 10655
30 % 3 7 9855
Entity #30 | Chains: CP
KRR1 small subunit processome component protein, length: 322 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 8 9176
95 % 3 8 9365
90 % 3 8 9699
70 % 3 11 7395
50 % 3 11 6809
40 % 3 11 6586
30 % 3 11 5868
Entity #31 | Chains: CQ
Pre-rRNA-processing protein PNO1 protein, length: 259 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13068
95 % 3 7 12587
90 % 3 7 12411
70 % 3 7 11814
50 % 3 7 11245
40 % 3 7 10588
30 % 3 7 9790
Entity #32 | Chains: CR,CS
Kre33 protein, length: 1073 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 8 4334
95 % 3 8 4972
90 % 3 8 5197
70 % 3 8 4980
50 % 3 8 5043
40 % 3 8 4918
30 % 3 8 4742
Entity #33 | Chains: CT
Fcf2 protein, length: 203 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 12820
95 % 3 7 13142
90 % 3 7 12958
70 % 3 7 12316
50 % 3 7 11254
40 % 3 7 10596
30 % 3 7 9798
Entity #34 | Chains: Ca
40S ribosomal protein S1 protein, length: 255 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 5 17717
95 % 3 5 16618
90 % 3 5 16325
70 % 41 81 488
50 % 46 137 360
40 % 48 144 349
30 % 48 144 365
Entity #35 | Chains: Cb
40S ribosomal protein S4 protein, length: 264 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 5 18120
95 % 2 5 17272
90 % 2 5 16943
70 % 45 163 264
50 % 47 173 263
40 % 47 177 266
30 % 47 182 270
Entity #36 | Chains: Cc
40S ribosomal protein s5-like protein protein, length: 212 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13406
95 % 3 7 13215
90 % 3 7 13034
70 % 8 93 624
50 % 49 183 230
40 % 49 183 243
30 % 49 183 258
Entity #37 | Chains: Cd
40S ribosomal protein S6 protein, length: 239 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 5 17751
95 % 2 5 16617
90 % 2 5 16324
70 % 7 83 707
50 % 46 164 305
40 % 46 169 303
30 % 46 169 323
Entity #38 | Chains: Ce
40S ribosomal protein S7 protein, length: 203 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13408
95 % 3 7 13217
90 % 3 7 13035
70 % 3 7 12382
50 % 46 170 287
40 % 46 170 297
30 % 48 173 299
Entity #39 | Chains: Cf
40S ribosomal protein S8 protein, length: 202 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 5 18119
95 % 2 5 17270
90 % 2 5 16942
70 % 40 83 475
50 % 47 172 267
40 % 47 176 268
30 % 47 176 286
Entity #4 | Chains: UD
Utp4 protein, length: 884 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 4 8 8833
95 % 4 8 9606
90 % 4 8 9184
70 % 4 8 8925
50 % 4 8 8289
40 % 4 8 7982
30 % 4 8 7469
Entity #40 | Chains: Cg
40S ribosomal protein s9-like protein protein, length: 190 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 12532
95 % 3 7 12568
90 % 3 7 12392
70 % 47 167 255
50 % 49 182 234
40 % 49 186 240
30 % 49 186 252
Entity #41 | Chains: Ch
40S ribosomal protein S13-like protein protein, length: 151 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 12711
95 % 3 7 12895
90 % 3 7 12728
70 % 47 172 249
50 % 49 179 244
40 % 49 184 242
30 % 49 184 254
Entity #42 | Chains: Ci
40S ribosomal protein S14-like protein protein, length: 150 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13251
95 % 3 7 12908
90 % 7 73 788
70 % 49 180 226
50 % 49 181 236
40 % 49 181 247
30 % 49 181 263
Entity #43 | Chains: Cj
40S ribosomal protein S16-like protein protein, length: 143 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13002
95 % 3 7 12446
90 % 3 7 12280
70 % 3 7 11695
50 % 49 174 256
40 % 49 178 259
30 % 49 179 276
Entity #44 | Chains: Ck
40S ribosomal protein S11-like protein protein, length: 161 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 5 18469
95 % 2 5 17832
90 % 2 5 17491
70 % 41 85 465
50 % 48 179 243
40 % 48 179 253
30 % 48 179 273
Entity #45 | Chains: Cm
40S ribosomal protein S22-like protein protein, length: 130 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13003
95 % 3 7 12354
90 % 3 7 12281
70 % 48 182 235
50 % 51 190 227
40 % 51 190 237
30 % 406 744 24
Entity #46 | Chains: Cn
40S ribosomal protein s23-like protein protein, length: 145 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13297
95 % 3 7 12699
90 % 3 7 12382
70 % 49 186 212
50 % 49 192 224
40 % 49 192 235
30 % 49 192 244
Entity #47 | Chains: Co
40S ribosomal protein S24 protein, length: 136 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 5 19640
95 % 2 5 17864
90 % 2 5 17519
70 % 2 5 16332
50 % 45 174 272
40 % 45 174 284
30 % 45 174 306
Entity #48 | Chains: Cp
40S ribosomal protein S28-like protein protein, length: 68 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13391
95 % 3 7 13193
90 % 3 7 13013
70 % 47 173 248
50 % 49 180 241
40 % 49 181 248
30 % 49 181 269
Entity #49 | Chains: CU
Faf1 protein, length: 311 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 12529
95 % 3 7 12703
90 % 3 7 12822
70 % 3 7 11786
50 % 3 7 10758
40 % 3 7 10131
30 % 3 7 9381
Entity #5 | Chains: UF
Utp6 protein, length: 414 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13415
95 % 3 7 13223
90 % 3 7 12555
70 % 3 7 12390
50 % 3 7 11324
40 % 3 7 10656
30 % 3 7 9856
Entity #50 | Chains: C1
35S ribosomal RNA rna, length: 2352 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
Entity #51 | Chains: C2
U3 snoRNA rna, length: 230 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
Entity #52 | Chains: UV
U3 small nucleolar RNA-associated protein 22 protein, length: 1171 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 4 28853
95 % 1 4 23843
90 % 1 4 20974
70 % 1 4 18721
50 % 1 4 16684
40 % 1 4 17191
30 % 1 4 15447
Entity #53 | Chains: CV
Rrp7 protein, length: 322 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 4 29673
95 % 1 4 24971
90 % 1 4 20912
70 % 1 4 19270
50 % 1 4 19477
40 % 1 4 15811
30 % 1 4 14263
Entity #54 | Chains: CW
Ribosome biogenesis protein ENP2 protein, length: 668 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 4 28091
95 % 2 4 22788
90 % 2 4 22130
70 % 2 4 20282
50 % 2 4 17978
40 % 2 4 16568
30 % 2 4 14924
Entity #55 | Chains: UT
Utp20 protein, length: 2612 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 4 28589
95 % 2 4 22787
90 % 2 4 22129
70 % 2 4 20280
50 % 2 4 17977
40 % 2 4 16567
30 % 2 4 14923
Entity #56 | Chains: UH
Utp8 protein, length: 930 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 6 15987
95 % 3 6 13919
90 % 3 6 15056
70 % 3 6 12973
50 % 3 6 11619
40 % 3 6 11108
30 % 3 6 11004
Entity #57 | Chains: UE,UI
Utp5 protein, length: 410 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 6 6999
95 % 3 6 7589
90 % 3 6 7573
70 % 3 6 7040
50 % 3 6 6677
40 % 3 6 6751
30 % 3 6 6347
Entity #58 | Chains: US
Noc4 protein, length: 549 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 6 16163
95 % 3 6 14198
90 % 3 6 14258
70 % 3 6 14154
50 % 3 6 12288
40 % 3 6 11956
30 % 3 6 10560
Entity #59 | Chains: Cl
Rps18 protein, length: 156 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 6 16763
95 % 3 6 15157
90 % 3 6 14908
70 % 47 165 258
50 % 49 174 257
40 % 49 180 252
30 % 49 180 272
Entity #6 | Chains: UG
Utp7 protein, length: 558 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13061
95 % 3 7 12574
90 % 3 7 12397
70 % 3 7 11796
50 % 3 7 10772
40 % 3 9 7980
30 % 3 9 7959
Entity #60 | Chains: CX
Enp1 protein, length: 480 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 6 17621
95 % 3 6 16483
90 % 3 6 16180
70 % 3 6 15153
50 % 3 6 13677
40 % 3 6 12744
30 % 3 14 5131
Entity #61 | Chains: CY
U3 small nucleolar ribonucleoprotein protein lcp5-like protein protein, length: 381 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 3 34196
95 % 2 3 26887
90 % 2 3 25934
70 % 2 3 23644
50 % 2 3 20767
40 % 2 3 19010
30 % 2 3 17059
Entity #62 | Chains: CZ
Bfr2 protein, length: 609 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 4 25226
95 % 2 4 18806
90 % 2 4 18390
70 % 2 4 17101
50 % 2 4 15385
40 % 2 4 14307
30 % 2 4 13023
Entity #63 | Chains: UP
Utp16 protein, length: 364 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 6 16762
95 % 3 6 15156
90 % 3 6 14136
70 % 3 6 14046
50 % 3 6 12181
40 % 3 6 11389
30 % 3 6 10916
Entity #7 | Chains: UJ
UTP10 protein, length: 1802 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 8 10718
95 % 3 8 11934
90 % 3 8 11756
70 % 3 8 11252
50 % 3 8 10297
40 % 3 8 9712
30 % 3 8 9002
Entity #8 | Chains: UK
U3 small nucleolar RNA-associated protein 11 protein, length: 270 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13413
95 % 3 7 13221
90 % 3 7 13039
70 % 3 7 12388
50 % 3 7 11322
40 % 3 7 10654
30 % 3 7 9539
Entity #9 | Chains: UL
Utp12 protein, length: 962 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13412
95 % 3 7 13220
90 % 3 7 13038
70 % 3 7 12387
50 % 3 7 11321
40 % 3 11 6812
30 % 3 11 6484


In the table for each entity, view a list of similar sequences by selecting the link associated with the percentage cutoff.

View more detailed documentation on the redundancy reduction and sequence clustering procedure used by RCSB PDB.

You can also use the structure comparison tool to compare any 2 given structures

ACTION - (A) Select for download / view details OR (B) Select two chains for comparison
Rank PDB ID Entity ID Chains Description Details Taxonomy EC Number
1 4V88 16 AO, CO 40S ribosomal protein S14-A 4932
2 4U4R 16 C4, c4 40S ribosomal protein S14-A 4932
3 4U3U 16 C4, c4 40S ribosomal protein S14-A 4932
4 5TBW 63 P, c4 40S ribosomal protein S14-B 4932
5 4U3M 16 C4, c4 40S ribosomal protein S14-A 4932
6 4U3N 16 C4, c4 40S ribosomal protein S14-A 4932
7 4U52 16 C4, c4 40S ribosomal protein S14-A 4932
8 4U4Q 16 C4, c4 40S ribosomal protein S14-A 4932
9 4U6F 16 C4, c4 40S ribosomal protein S14-A 4932
10 4U4U 16 C4, c4 40S ribosomal protein S14-A 4932
11 4U4Z 16 C4, c4 40S ribosomal protein S14-A 4932
12 4U4Y 16 C4, c4 40S ribosomal protein S14-A 4932
13 4U4N 16 C4, c4 40S ribosomal protein S14-A 4932
14 4U55 16 C4, c4 40S ribosomal protein S14-A 4932
15 5DAT 16 C4, c4 40S ribosomal protein S14-A 4932
16 5I4L 16 C4, c4 40S ribosomal protein S14-B 4932
17 4U51 16 C4, c4 40S ribosomal protein S14-A 4932
18 6HHQ 62 P, c4 40S ribosomal protein S14-B 4932
19 5OBM 60 C4, c4 40S ribosomal protein S14-B 4932
20 4U53 16 C4, c4 40S ribosomal protein S14-A 4932
21 5ON6 64 P, c4 40S ribosomal protein S14-B 4932
22 4U50 16 C4, c4 40S ribosomal protein S14-A 4932
23 5NDV 60 C4, c4 40S ribosomal protein S14-B 4932
24 5LYB 16 C4, c4 40S Ribosomal Protein S14 4932
25 4U56 16 C4, c4 40S ribosomal protein S14-A 4932
26 5TGA 16 C4, c4 40S ribosomal protein S14-B 4932
27 5MEI 63 P, c4 40S ribosomal protein S14-B 4932
28 5FCJ 16 C4, c4 40S ribosomal protein S14-A (UNK) residues correspond to residues that aren't well resolved, and for which side-chains could not be modeled. (UNK)s were substituted in the original sequence of the crystallized protein. Remaining misalignments result from differences in the distribution of (UNK)s between the two instances of the molecule in the structure. Here is the original sequence ot the crystallized protein : SNVVQARDNSQVFGVARIYASFNDTFVHVTDLSGKETIARVTGGMKVKADRDESSPYAAMLAAQDVAAKCKEVGITAVHV KIRATGGTRTKTPGPGGQAALRALARSGLRIGRIEDVTPVPSDSTRKKGGRRGRRL 4932
29 4U4O 16 C4, c4 40S ribosomal protein S14-A 4932
30 5DGV 16 C4, c4 40S ribosomal protein S14-A 4932
31 5DGE 16 C4, c4 40S ribosomal protein S14-A 4932
32 5NDW 9 C4, c4 40S ribosomal protein S14-B 4932
34 5NDG 16 C4, c4 40S ribosomal protein S14-A 4932
35 5FCI 16 C4, c4 40S ribosomal protein S14-A (UNK) residues correspond to residues that aren't well resolved, and for which side-chains could not be modeled. (UNK)s were substituted in the original sequence of the crystallized protein. Remaining misalignments result from differences in the distribution of (UNK)s between the two instances of the molecule in the structure. Here is the original sequence ot the crystallized protein : SNVVQARDNSQVFGVARIYASFNDTFVHVTDLSGKETIARVTGGMKVKADRDESSPYAAMLAAQDVAAKCKEVGITAVHV KIRATGGTRTKTPGPGGQAALRALARSGLRIGRIEDVTPVPSDSTRKKGGRRGRRL 4932
36 5DC3 16 C4, c4 40S ribosomal protein S14-A 4932
37 5DGF 16 C4, c4 40S ribosomal protein S14-A 4932
38 4V5O 20 AK, BK RPS14E 5911
39 5TGM 16 C4, c4 40S ribosomal protein S14-A 4932
40 4V7R 9 AH, CH 40S ribosomal protein S14-A 4932
41 5VYC 15 O1, O2, O3, O4, O5, O6 40S ribosomal protein S14 9606
42 4KZZ 15 O 40S Ribosomal Protein S14 9986
43 4KZX 15 O 40S ribosomal protein S14 9986
44 4KZY 15 O 40S Ribosomal Protein S14 9986
45 6SGC 16 P1 uS11 9986
46 6S47 60 BP 40S ribosomal protein S14-A 4932
47 6RXT 39 Ci 40S ribosomal protein S14-like protein 209285
48 6RXU 42 Ci 40S ribosomal protein S14-like protein 209285
49 6RXV 42 Ci 40S ribosomal protein S14-like protein 209285
50 6RXX 24 Ci 40S ribosomal protein S14-like protein 209285
51 6RXY 38 Ci 40S ribosomal protein S14-like protein 209285
52 6RXZ 41 Ci 40S ribosomal protein S14-like protein 209285
53 6P5I 16 P uS11 9986
54 6P5J 16 P uS11 9986
55 6P5K 62 P uS11 9986
56 6P5N 62 P uS11 9986
57 6P4G 16 P uS11 9986
58 6P4H 17 P uS11 9986
59 6OM7 28 SO 40S ribosomal protein S14 9606
60 6OLZ 61 BO 40S ribosomal protein S14 9606
61 6OM0 28 SO 40S ribosomal protein S14 9606
62 6OLE 28 SO 40S ribosomal protein S14 9606
63 6OLF 28 SO 40S ribosomal protein S14 9606
64 6OLG 64 BO 40S ribosomal protein S14 9606
65 6OLI 28 SO 40S ribosomal protein S14 9606
66 6OKK 16 P 40S ribosomal protein S11 5833
67 6RBD 27 O 40S ribosomal protein S14-A 4932
68 6RBE 12 O 40S ribosomal protein S14-A 4932
69 6R7Q 13 MM uS11 9986
70 6R6G 36 MM 40S ribosomal protein S14 9986
71 6R6P 62 MM uS11 9986
72 6R5Q 66 MM uS11 9986
73 6QZP 75 SO 40S ribosomal protein S14 9606
74 6Q8Y 81 Z 40S ribosomal protein S14-B 4932
75 6I7O 33 Z, Zb 40S ribosomal protein S14-B 4932
76 6IP5 74 3L 40S ribosomal protein S14 9606
77 6IP6 73 3L 40S ribosomal protein S14 9606
78 6IP8 73 3L 40S ribosomal protein S14 9606
79 6MTB 65 OO 40S ribosomal protein S14 9986
80 6MTC 64 OO 40S ribosomal protein S14 9986
81 6MTD 66 OO uS11 9986
82 6MTE 65 OO uS11 9986
83 6HCQ 19 P2 uS11 9986
84 6HCJ 19 P2 uS11 9986
85 6HCM 16 P1 uS11 9986
86 6HCF 16 P1 uS11 9986
87 6GZ3 31 BO ribosomal protein uS11 9986
88 6GZ4 34 BO ribosomal protein uS11 9986
89 6GZ5 31 BO ribosomal protein uS11 9986
90 6GSM 18 O 40S ribosomal protein S14 28985
91 6GSN 38 O 40S ribosomal protein S14 28985
92 6GQV 62 AE 40S ribosomal protein S14-B 4932
93 6GQ1 62 AE 40S ribosomal protein S14-B 4932
94 6GQB 62 AE 40S ribosomal protein S14-B 4932
95 6D9J 64 PP uS11 9986
96 6D90 65 PP uS11 9986
97 6G5H 12 O 40S ribosomal protein S14 9606
98 6G5I 16 O 40S ribosomal protein S14 9606
99 6G4S 27 O 40S ribosomal protein S14 9606
100 6G4W 23 O 40S ribosomal protein S14 9606
101 6G51 13 O 40S ribosomal protein S14 9606
102 6G53 13 O 40S ribosomal protein S14 9606
103 6G18 23 O 40S ribosomal protein S14 9606
104 6FYX 18 O 40S ribosomal protein S14 28985
105 6FYY 18 O 40S ribosomal protein S14 28985
106 6FEC 38 j 40S ribosomal protein S14 9606
107 6FAI 25 O 40S ribosomal protein S14-A 4932
108 6EML 22 Z 40S ribosomal protein S14-A 4932
109 6EK0 75 SO 40S ribosomal protein S14 9606
110 6AZ1 15 O ribosomal protein S11 5661
111 5OQL 42 t 40S ribosomal protein S14-like protein 209285
112 5OPT 14 V 40S ribosomal protein S14, putative 5693
113 5WLC 40 NG rpS14_uS11 4932
114 5XXU 16 O Ribosomal protein uS11 5811
115 5OA3 19 O 40S ribosomal protein S14 9606
116 5WYJ 45 SP 40S ribosomal protein S14-A 4932
117 5WYK 41 SP 40S ribosomal protein S14-A 4932
118 5MC6 27 Z 40S ribosomal protein S14-A 4932
119 5M1J 22 O2 40S ribosomal protein S14-A 4932
120 5LZS 65 OO uS11 9986
121 5LZT 66 OO uS11 9986
122 5LZU 65 OO uS11 9986
123 5LZV 66 OO uS11 9986
124 5LZW 66 OO uS11 9986
125 5LZX 66 OO uS11 9986
126 5LZY 64 OO uS11 9986
127 5LZZ 66 OO uS11 9986
128 5T2A 63 AH uS11 5661
129 5T2C 80 AO 40S ribosomal protein S14 9606
130 5LL6 12 Z 40S ribosomal protein S14-A 4932
131 5LKS 74 SO 40S ribosomal protein S14 9606
132 5K0Y 32 j ribosomal protein uS11 9986
133 5JUO 64 LB uS11 (yeast S14) 4932
134 5JUP 64 LB uS11 (yeast S14) 4932
135 5JUS 64 LB uS11 (yeast S14) 4932
136 5JUT 64 LB uS11 (yeast S14) 4932
137 5JUU 64 LB uS11 (yeast S14) 4932
138 5JPQ 29 w uS11 209285
139 5IT7 62 O 40S ribosomal protein S14 28985
140 5IT9 15 O Ribosomal protein uS14 28985
141 5FLX 16 O 40S RIBOSOMAL PROTEIN S14 9986
142 3JAP 18 O uS11 28985
143 3JAQ 18 O uS11 28985
144 3JAM 16 O uS11 28985
145 3JAN 64 SO Ribosomal protein uS11 SEE REMARK 999 9986
146 3JAJ 65 SO Ribosomal protein uS11 SEE REMARK 999 9986
147 3JAG 66 OO uS11 9986
148 3JAH 66 OO uS11 9986
149 3JAI 66 OO uS11 9986
151 4UG0 76 SO 40S RIBOSOMAL PROTEIN S14 9606
152 5AJ0 64 BO 40S ribosomal protein S14 9606
153 4UER 21 K US11 4934
154 4D61 16 O 40S RIBOSOMAL PROTEIN S14 9986
155 4D5L 16 O 40S RIBOSOMAL PROTEIN US11 9986
156 3J81 16 O uS11 28985
157 3J80 12 O uS11 28985
158 3J7P 64 SO Ribosomal protein uS11 9823
159 3J7R 65 SO Ribosomal protein uS11 9823
162 3J7A 16 P 40S ribosomal protein uS11 5833
163 3J77 60 14 40S ribosomal protein S14 4932
164 3J78 60 14 40S ribosomal protein S14 4932
165 3J6X 61 14 40S ribosomal protein S14 4932
166 3J6Y 61 14 40S ribosomal protein S14 4932
168 4V92 17 BO US11 28985
169 4V7E 16 BO 40S ribosomal protein S11 4565
170 4V8Y 23 AO 40S RIBOSOMAL PROTEIN S14-A 4932
171 4V8Z 23 AO 40S RIBOSOMAL PROTEIN S14-A 4932
172 4V6W 5 AO 40S ribosomal protein S14 7227
173 4V6X 5 AO 40S ribosomal protein S14 9606
174 4V8M 16 AH 40S RIBOSOMAL PROTEIN S14 185431
175 3J0O 12 K Ribosomal protein S14 9986
176 3J0L 12 K Ribosomal protein S14 9986
177 4V6I 12 AK 40S ribosomal protein rpS14 (S11p) 4932
178 4V7H 10 AK 40S ribosomal protein S14(A) 5541
179 4V5Z 18 Ak 40S Ribosomal protein S14e 9612
180 4V4B 11 AK 40S ribosomal protein S14-A 4932