Cryo-EM structure of the 90S pre-ribosome (Kre33-Noc4) from Chaetomium thermophilum, state B2

Sequence Similarity Clusters for the Entities in PDB 6RXV

Entity #1 | Chains: UA
Periodic tryptophan protein 2-like protein protein, length: 904 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13092
95 % 3 7 12500
90 % 3 7 12306
70 % 3 7 11725
50 % 3 11 7127
40 % 3 11 6871
30 % 3 11 6447
Entity #10 | Chains: UM
Utp13 protein, length: 912 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 12541
95 % 3 7 12456
90 % 3 7 12520
70 % 3 7 11685
50 % 3 7 10890
40 % 3 7 10244
30 % 3 7 9295
Entity #11 | Chains: UN
Utp14 protein, length: 938 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 12903
95 % 3 7 13216
90 % 3 7 13030
70 % 3 7 12350
50 % 3 7 11301
40 % 3 7 10632
30 % 3 7 9809
Entity #12 | Chains: UO
Utp15 protein, length: 557 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13383
95 % 3 7 13055
90 % 3 7 12863
70 % 3 7 12214
50 % 3 7 11167
40 % 3 7 10510
30 % 3 9 7877
Entity #13 | Chains: UQ
Utp17 protein, length: 960 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13156
95 % 3 7 12599
90 % 3 7 12402
70 % 3 7 11802
50 % 3 7 10792
40 % 3 7 10153
30 % 3 7 9383
Entity #14 | Chains: UR
Utp18 protein, length: 618 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 12756
95 % 3 7 12916
90 % 3 7 12726
70 % 3 7 12104
50 % 3 7 11058
40 % 3 7 10393
30 % 3 11 6614
Entity #15 | Chains: UU
Utp21 protein, length: 1049 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13155
95 % 3 7 12598
90 % 3 7 12401
70 % 3 7 11801
50 % 3 7 10791
40 % 3 7 10152
30 % 3 7 9382
Entity #16 | Chains: UX
Utp24 protein, length: 193 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 8 12132
95 % 3 8 11533
90 % 3 8 11361
70 % 3 8 10886
50 % 3 12 6452
40 % 3 12 6252
30 % 3 12 5935
Entity #17 | Chains: UZ
Utp30 protein, length: 391 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13036
95 % 3 7 13315
90 % 3 7 13264
70 % 3 7 12105
50 % 3 7 11059
40 % 3 7 10394
30 % 3 7 9591
Entity #18 | Chains: CA,CB
Nop1 protein, length: 313 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 5426
95 % 3 7 6229
90 % 3 7 6252
70 % 3 7 6165
50 % 3 11 3621
40 % 3 11 3605
30 % 3 11 3523
Entity #19 | Chains: CC
Nop56 protein, length: 523 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13154
95 % 3 7 12597
90 % 3 7 12400
70 % 3 7 11800
50 % 3 11 7120
40 % 3 15 5060
30 % 3 15 4857
Entity #2 | Chains: UB
Utp2 protein, length: 907 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13552
95 % 3 7 13443
90 % 3 7 12761
70 % 3 7 12125
50 % 3 7 11464
40 % 3 7 10780
30 % 3 7 9939
Entity #20 | Chains: CD
Nop58 protein, length: 582 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 12639
95 % 3 7 12820
90 % 3 7 12623
70 % 3 7 11887
50 % 3 7 10870
40 % 3 7 10314
30 % 3 7 9520
Entity #21 | Chains: CE,CF
Snu13 protein, length: 127 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 5425
95 % 3 7 6228
90 % 3 7 6251
70 % 3 7 6164
50 % 12 34 1339
40 % 13 35 1328
30 % 12 34 1419
Entity #22 | Chains: CG
Rrp9 protein, length: 630 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 12884
95 % 3 7 13173
90 % 3 7 12994
70 % 3 7 12312
50 % 3 7 11263
40 % 3 7 10601
30 % 3 7 9775
Entity #23 | Chains: CH
RNA 3'-terminal phosphate cyclase-like protein protein, length: 411 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13348
95 % 3 7 12986
90 % 3 7 12797
70 % 3 7 12157
50 % 3 7 11114
40 % 3 7 10447
30 % 3 7 9638
Entity #24 | Chains: CI
Bms1 protein, length: 1163 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 12956
95 % 3 7 13309
90 % 3 7 13119
70 % 3 7 12434
50 % 3 7 11387
40 % 3 11 7171
30 % 3 11 6737
Entity #25 | Chains: CJ
Imp3 protein, length: 183 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 8 12134
95 % 3 8 11813
90 % 3 8 11644
70 % 3 8 11122
50 % 3 12 6862
40 % 3 12 6637
30 % 3 12 6251
Entity #26 | Chains: CK
Imp4 protein, length: 297 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 8 12133
95 % 3 8 10220
90 % 3 8 11643
70 % 3 8 9806
50 % 3 11 7441
40 % 3 11 7167
30 % 3 11 6734
Entity #27 | Chains: CL
Mpp10 protein, length: 785 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13349
95 % 3 7 12987
90 % 3 7 12798
70 % 3 7 11900
50 % 3 7 11115
40 % 3 7 10234
30 % 3 7 9639
Entity #28 | Chains: CM
Sof1 protein, length: 446 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13350
95 % 3 7 12988
90 % 3 7 12799
70 % 3 7 12158
50 % 3 7 11116
40 % 3 9 8359
30 % 3 9 7806
Entity #29 | Chains: CN,CO
Emg1 protein, length: 252 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 4990
95 % 3 7 5911
90 % 3 7 5956
70 % 8 17 2319
50 % 8 17 2371
40 % 8 17 2388
30 % 8 17 2378
Entity #3 | Chains: UC
Utp3 protein, length: 648 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13093
95 % 3 7 12956
90 % 3 7 12307
70 % 3 7 11726
50 % 3 7 10714
40 % 3 7 10081
30 % 3 7 9323
Entity #30 | Chains: CP
KRR1 small subunit processome component protein, length: 322 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 8 9285
95 % 3 8 9519
90 % 3 8 9452
70 % 3 11 6841
50 % 3 11 6500
40 % 3 11 6297
30 % 3 11 5965
Entity #31 | Chains: CQ
Pre-rRNA-processing protein PNO1 protein, length: 259 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 12757
95 % 3 7 12917
90 % 3 7 12727
70 % 3 7 12106
50 % 3 7 11061
40 % 3 7 10395
30 % 3 7 9592
Entity #32 | Chains: CR,CS
Kre33 protein, length: 1073 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 8 4095
95 % 3 8 5017
90 % 3 8 5074
70 % 3 8 5020
50 % 3 8 4873
40 % 3 8 4765
30 % 3 8 4610
Entity #33 | Chains: CT
Fcf2 protein, length: 203 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 12958
95 % 3 7 13314
90 % 3 7 13123
70 % 3 7 12437
50 % 3 7 11389
40 % 3 7 10711
30 % 3 7 9876
Entity #34 | Chains: Ca
40S ribosomal protein S1 protein, length: 255 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 5 18280
95 % 3 5 17403
90 % 3 5 17055
70 % 46 86 468
50 % 51 142 348
40 % 53 149 346
30 % 53 149 362
Entity #35 | Chains: Cb
40S ribosomal protein S4 protein, length: 264 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 5 17910
95 % 2 5 16818
90 % 2 5 16580
70 % 50 168 264
50 % 52 178 261
40 % 52 182 263
30 % 52 187 263
Entity #36 | Chains: Cc
40S ribosomal protein s5-like protein protein, length: 212 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13545
95 % 3 7 13387
90 % 3 7 13204
70 % 8 93 626
50 % 54 188 233
40 % 54 188 241
30 % 54 188 253
Entity #37 | Chains: Cd
40S ribosomal protein S6 protein, length: 239 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 5 19391
95 % 2 5 17254
90 % 2 5 16919
70 % 7 83 712
50 % 51 169 299
40 % 51 174 300
30 % 51 174 324
Entity #38 | Chains: Ce
40S ribosomal protein S7 protein, length: 203 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13224
95 % 3 7 12747
90 % 3 7 12546
70 % 3 7 11937
50 % 51 175 282
40 % 51 175 293
30 % 53 178 296
Entity #39 | Chains: Cf
40S ribosomal protein S8 protein, length: 202 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 5 19390
95 % 2 5 17253
90 % 2 5 16918
70 % 45 88 456
50 % 52 177 265
40 % 52 181 264
30 % 52 181 285
Entity #4 | Chains: UD
Utp4 protein, length: 884 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 4 8 9204
95 % 4 8 9366
90 % 4 8 9295
70 % 4 8 9033
50 % 4 8 8393
40 % 4 8 8070
30 % 4 8 7528
Entity #40 | Chains: Cg
40S ribosomal protein s9-like protein protein, length: 190 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13223
95 % 3 7 12746
90 % 3 7 12545
70 % 52 172 257
50 % 54 187 234
40 % 54 191 239
30 % 54 191 249
Entity #41 | Chains: Ch
40S ribosomal protein S13-like protein protein, length: 151 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13255
95 % 3 7 12802
90 % 3 7 12605
70 % 52 181 243
50 % 54 184 241
40 % 54 189 240
30 % 54 189 252
Entity #42 | Chains: Ci
40S ribosomal protein S14-like protein protein, length: 150 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13301
95 % 3 7 12894
90 % 7 73 795
70 % 54 185 219
50 % 54 186 235
40 % 54 186 245
30 % 54 186 260
Entity #43 | Chains: Cj
40S ribosomal protein S16-like protein protein, length: 143 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13225
95 % 3 7 12748
90 % 3 7 12547
70 % 3 7 11938
50 % 54 179 252
40 % 54 183 253
30 % 54 184 267
Entity #44 | Chains: Ck
40S ribosomal protein S11-like protein protein, length: 161 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 5 19896
95 % 2 5 18070
90 % 2 5 17727
70 % 46 90 438
50 % 53 184 240
40 % 53 184 248
30 % 53 184 266
Entity #45 | Chains: Cm
40S ribosomal protein S22-like protein protein, length: 130 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13398
95 % 3 7 13085
90 % 3 7 12903
70 % 53 188 227
50 % 56 195 228
40 % 56 195 235
30 % 414 752 23
Entity #46 | Chains: Cn
40S ribosomal protein s23-like protein protein, length: 145 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13440
95 % 3 7 12719
90 % 3 7 12670
70 % 54 191 210
50 % 54 197 224
40 % 54 197 232
30 % 54 197 245
Entity #47 | Chains: Co
40S ribosomal protein S24 protein, length: 136 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 5 20258
95 % 2 5 18233
90 % 2 5 18170
70 % 2 5 16212
50 % 50 179 270
40 % 50 179 281
30 % 50 179 305
Entity #48 | Chains: Cp
40S ribosomal protein S28-like protein protein, length: 68 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13302
95 % 3 7 12895
90 % 3 7 12993
70 % 52 178 249
50 % 54 185 236
40 % 54 186 244
30 % 54 186 258
Entity #49 | Chains: CU
Faf1 protein, length: 311 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13399
95 % 3 7 13086
90 % 3 7 12904
70 % 3 7 12406
50 % 3 7 11357
40 % 3 7 10681
30 % 3 7 9716
Entity #5 | Chains: UF
Utp6 protein, length: 414 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 12962
95 % 3 7 13317
90 % 3 7 13213
70 % 3 7 12444
50 % 3 7 11393
40 % 3 7 10714
30 % 3 7 9882
Entity #50 | Chains: C1
35S ribosomal RNA rna, length: 2352 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
Entity #51 | Chains: C2
U3 snoRNA rna, length: 230 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
Entity #52 | Chains: UV
U3 small nucleolar RNA-associated protein 22 protein, length: 1171 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 4 29130
95 % 1 4 24091
90 % 1 4 23359
70 % 1 4 19517
50 % 1 4 17345
40 % 1 4 17358
30 % 1 4 15636
Entity #53 | Chains: CV
Rrp7 protein, length: 322 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 4 25361
95 % 1 4 25637
90 % 1 4 24819
70 % 1 4 22643
50 % 1 4 19951
40 % 1 4 18284
30 % 1 4 16405
Entity #54 | Chains: CW
Ribosome biogenesis protein ENP2 protein, length: 668 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 4 26688
95 % 2 4 20737
90 % 2 4 20240
70 % 2 4 18678
50 % 2 4 18149
40 % 2 4 16722
30 % 2 4 13984
Entity #55 | Chains: UT
Utp20 protein, length: 2612 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 4 30240
95 % 2 4 23535
90 % 2 4 22838
70 % 2 4 22516
50 % 2 4 19846
40 % 2 4 18201
30 % 2 4 15367
Entity #56 | Chains: UH
Utp8 protein, length: 930 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 6 16152
95 % 3 6 13749
90 % 3 6 13529
70 % 3 6 12679
50 % 3 6 11992
40 % 3 6 11261
30 % 3 6 10361
Entity #57 | Chains: UE,UI
Utp5 protein, length: 410 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 6 6668
95 % 3 6 7271
90 % 3 6 7260
70 % 3 6 6809
50 % 3 6 6479
40 % 3 6 6524
30 % 3 6 6175
Entity #58 | Chains: US
Noc4 protein, length: 549 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 6 16321
95 % 3 6 15418
90 % 3 6 15178
70 % 3 6 13625
50 % 3 6 12968
40 % 3 6 12090
30 % 3 6 11085
Entity #59 | Chains: Cl
Rps18 protein, length: 156 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 6 17347
95 % 3 6 15905
90 % 3 6 15653
70 % 52 170 260
50 % 54 179 258
40 % 54 185 247
30 % 54 185 265
Entity #6 | Chains: UG
Utp7 protein, length: 558 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 12961
95 % 3 7 13316
90 % 3 7 13128
70 % 3 7 12443
50 % 3 7 11392
40 % 3 9 8134
30 % 3 9 7579
Entity #60 | Chains: CX
Enp1 protein, length: 480 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 6 17817
95 % 3 6 16669
90 % 3 6 16375
70 % 3 6 15311
50 % 3 6 13841
40 % 3 6 12871
30 % 3 14 5191
Entity #61 | Chains: CY
U3 small nucleolar ribonucleoprotein protein lcp5-like protein protein, length: 381 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 3 33848
95 % 2 3 26678
90 % 2 3 25755
70 % 2 3 22994
50 % 2 3 20237
40 % 2 3 18530
30 % 2 3 16620
Entity #62 | Chains: CZ
Bfr2 protein, length: 609 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 4 28348
95 % 2 4 23046
90 % 2 4 22396
70 % 2 4 20514
50 % 2 4 18161
40 % 2 4 16735
30 % 2 4 15131
Entity #63 | Chains: UP
Utp16 protein, length: 364 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 6 15827
95 % 3 6 14263
90 % 3 6 15941
70 % 3 6 12676
50 % 3 6 11595
40 % 3 6 10905
30 % 3 6 10063
Entity #7 | Chains: UJ
UTP10 protein, length: 1802 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 8 10870
95 % 3 8 12096
90 % 3 8 11922
70 % 3 8 11347
50 % 3 8 10410
40 % 3 8 9813
30 % 3 8 9086
Entity #8 | Chains: UK
U3 small nucleolar RNA-associated protein 11 protein, length: 270 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 12963
95 % 3 7 13318
90 % 3 7 13129
70 % 3 7 12445
50 % 3 7 11394
40 % 3 7 10715
30 % 3 7 9883
Entity #9 | Chains: UL
Utp12 protein, length: 962 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13578
95 % 3 7 13432
90 % 3 7 13243
70 % 3 7 12561
50 % 3 7 11499
40 % 3 11 6977
30 % 3 11 6538


In the table for each entity, view a list of similar sequences by selecting the link associated with the percentage cutoff.

View more detailed documentation on the redundancy reduction and sequence clustering procedure used by RCSB PDB.

You can also use the structure comparison tool to compare any 2 given structures

ACTION - (A) Select for download / view details OR (B) Select two chains for comparison
Rank PDB ID Entity ID Chains Description Details Taxonomy EC Number
1 4V88 16 AO, CO 40S ribosomal protein S14-A 4932
2 4U4R 16 C4, c4 40S ribosomal protein S14-A 4932
3 4U3U 16 C4, c4 40S ribosomal protein S14-A 4932
4 5TBW 63 P, c4 40S ribosomal protein S14-B 4932
5 4U3M 16 C4, c4 40S ribosomal protein S14-A 4932
6 4U3N 16 C4, c4 40S ribosomal protein S14-A 4932
7 4U52 16 C4, c4 40S ribosomal protein S14-A 4932
8 4U4Q 16 C4, c4 40S ribosomal protein S14-A 4932
9 4U6F 16 C4, c4 40S ribosomal protein S14-A 4932
10 4U4U 16 C4, c4 40S ribosomal protein S14-A 4932
11 4U4Z 16 C4, c4 40S ribosomal protein S14-A 4932
12 4U4Y 16 C4, c4 40S ribosomal protein S14-A 4932
13 4U4N 16 C4, c4 40S ribosomal protein S14-A 4932
14 4U55 16 C4, c4 40S ribosomal protein S14-A 4932
15 5DAT 16 C4, c4 40S ribosomal protein S14-A 4932
16 5I4L 16 C4, c4 40S ribosomal protein S14-B 4932
17 4U51 16 C4, c4 40S ribosomal protein S14-A 4932
18 6HHQ 62 P, c4 40S ribosomal protein S14-B 4932
19 5OBM 60 C4, c4 40S ribosomal protein S14-B 4932
20 4U53 16 C4, c4 40S ribosomal protein S14-A 4932
21 5ON6 64 P, c4 40S ribosomal protein S14-B 4932
22 4U50 16 C4, c4 40S ribosomal protein S14-A 4932
23 5NDV 60 C4, c4 40S ribosomal protein S14-B 4932
24 5LYB 16 C4, c4 40S Ribosomal Protein S14 4932
25 4U56 16 C4, c4 40S ribosomal protein S14-A 4932
26 5TGA 16 C4, c4 40S ribosomal protein S14-B 4932
27 5MEI 63 P, c4 40S ribosomal protein S14-B 4932
28 5FCJ 16 C4, c4 40S ribosomal protein S14-A (UNK) residues correspond to residues that aren't well resolved, and for which side-chains could not be modeled. (UNK)s were substituted in the original sequence of the crystallized protein. Remaining misalignments result from differences in the distribution of (UNK)s between the two instances of the molecule in the structure. Here is the original sequence ot the crystallized protein : SNVVQARDNSQVFGVARIYASFNDTFVHVTDLSGKETIARVTGGMKVKADRDESSPYAAMLAAQDVAAKCKEVGITAVHV KIRATGGTRTKTPGPGGQAALRALARSGLRIGRIEDVTPVPSDSTRKKGGRRGRRL 4932
29 4U4O 16 C4, c4 40S ribosomal protein S14-A 4932
30 5DGV 16 C4, c4 40S ribosomal protein S14-A 4932
31 5DGE 16 C4, c4 40S ribosomal protein S14-A 4932
32 5NDW 9 C4, c4 40S ribosomal protein S14-B 4932
34 5NDG 16 C4, c4 40S ribosomal protein S14-A 4932
35 5FCI 16 C4, c4 40S ribosomal protein S14-A (UNK) residues correspond to residues that aren't well resolved, and for which side-chains could not be modeled. (UNK)s were substituted in the original sequence of the crystallized protein. Remaining misalignments result from differences in the distribution of (UNK)s between the two instances of the molecule in the structure. Here is the original sequence ot the crystallized protein : SNVVQARDNSQVFGVARIYASFNDTFVHVTDLSGKETIARVTGGMKVKADRDESSPYAAMLAAQDVAAKCKEVGITAVHV KIRATGGTRTKTPGPGGQAALRALARSGLRIGRIEDVTPVPSDSTRKKGGRRGRRL 4932
36 5DC3 16 C4, c4 40S ribosomal protein S14-A 4932
37 5DGF 16 C4, c4 40S ribosomal protein S14-A 4932
38 4V5O 20 AK, BK RPS14E 5911
39 5TGM 16 C4, c4 40S ribosomal protein S14-A 4932
40 4V7R 9 AH, CH 40S ribosomal protein S14-A 4932
41 5VYC 15 O1, O2, O3, O4, O5, O6 40S ribosomal protein S14 9606
42 4KZZ 15 O 40S Ribosomal Protein S14 9986
43 4KZX 15 O 40S ribosomal protein S14 9986
44 4KZY 15 O 40S Ribosomal Protein S14 9986
45 6UZ7 62 O 40S ribosomal protein S14 28985
46 6T83 17 Ob, p 40S ribosomal protein S14-A 4932
47 6T7T 17 SO 40S ribosomal protein S14-A 4932
48 6T7I 17 SO 40S ribosomal protein S14-A 4932
49 6T4Q 16 SO 40S ribosomal protein S14-B 4932
50 6SGC 16 P1 uS11 9986
51 6S47 60 BP 40S ribosomal protein S14-A 4932
52 6RXT 39 Ci 40S ribosomal protein S14-like protein 209285
53 6RXU 42 Ci 40S ribosomal protein S14-like protein 209285
54 6RXV 42 Ci 40S ribosomal protein S14-like protein 209285
55 6RXX 24 Ci 40S ribosomal protein S14-like protein 209285
56 6RXY 38 Ci 40S ribosomal protein S14-like protein 209285
57 6RXZ 41 Ci 40S ribosomal protein S14-like protein 209285
58 6P5I 16 P uS11 9986
59 6P5J 16 P uS11 9986
60 6P5K 62 P uS11 9986
61 6P5N 62 P uS11 9986
62 6P4G 16 P uS11 9986
63 6P4H 17 P uS11 9986
64 6OM7 28 SO 40S ribosomal protein S14 9606
65 6OLZ 61 BO 40S ribosomal protein S14 9606
66 6OM0 28 SO 40S ribosomal protein S14 9606
67 6OLE 28 SO 40S ribosomal protein S14 9606
68 6OLF 28 SO 40S ribosomal protein S14 9606
69 6OLG 64 BO 40S ribosomal protein S14 9606
70 6OLI 28 SO 40S ribosomal protein S14 9606
71 6OKK 16 P 40S ribosomal protein S11 5833
72 6RBD 27 O 40S ribosomal protein S14-A 4932
73 6RBE 12 O 40S ribosomal protein S14-A 4932
74 6R7Q 13 MM uS11 9986
75 6R6G 36 MM 40S ribosomal protein S14 9986
76 6R6P 62 MM uS11 9986
77 6R5Q 66 MM uS11 9986
78 6QZP 75 SO 40S ribosomal protein S14 9606
79 6Q8Y 81 Z 40S ribosomal protein S14-B 4932
80 6I7O 33 Z, Zb 40S ribosomal protein S14-B 4932
81 6IP5 74 3L 40S ribosomal protein S14 9606
82 6IP6 73 3L 40S ribosomal protein S14 9606
83 6IP8 73 3L 40S ribosomal protein S14 9606
84 6MTB 65 OO 40S ribosomal protein S14 9986
85 6MTC 64 OO 40S ribosomal protein S14 9986
86 6MTD 66 OO uS11 9986
87 6MTE 65 OO uS11 9986
88 6HCQ 19 P2 uS11 9986
89 6HCJ 19 P2 uS11 9986
90 6HCM 16 P1 uS11 9986
91 6HCF 16 P1 uS11 9986
92 6GZ3 31 BO ribosomal protein uS11 9986
93 6GZ4 34 BO ribosomal protein uS11 9986
94 6GZ5 31 BO ribosomal protein uS11 9986
95 6GSM 18 O 40S ribosomal protein S14 28985
96 6GSN 38 O 40S ribosomal protein S14 28985
97 6GQV 62 AE 40S ribosomal protein S14-B 4932
98 6GQ1 62 AE 40S ribosomal protein S14-B 4932
99 6GQB 62 AE 40S ribosomal protein S14-B 4932
100 6D9J 64 PP uS11 9986
101 6D90 65 PP uS11 9986
102 6G5H 12 O 40S ribosomal protein S14 9606
103 6G5I 16 O 40S ribosomal protein S14 9606
104 6G4S 27 O 40S ribosomal protein S14 9606
105 6G4W 23 O 40S ribosomal protein S14 9606
106 6G51 13 O 40S ribosomal protein S14 9606
107 6G53 13 O 40S ribosomal protein S14 9606
108 6G18 23 O 40S ribosomal protein S14 9606
109 6FYX 18 O 40S ribosomal protein S14 28985
110 6FYY 18 O 40S ribosomal protein S14 28985
111 6FEC 38 j 40S ribosomal protein S14 9606
112 6FAI 25 O 40S ribosomal protein S14-A 4932
113 6EML 22 Z 40S ribosomal protein S14-A 4932
114 6EK0 75 SO 40S ribosomal protein S14 9606
115 6AZ1 15 O ribosomal protein S11 5661
116 5OQL 42 t 40S ribosomal protein S14-like protein 209285
117 5OPT 14 V 40S ribosomal protein S14, putative 5693
118 5WLC 40 NG rpS14_uS11 4932
119 5XXU 16 O Ribosomal protein uS11 5811
120 5OA3 19 O 40S ribosomal protein S14 9606
121 5WYJ 45 SP 40S ribosomal protein S14-A 4932
122 5WYK 41 SP 40S ribosomal protein S14-A 4932
123 5MC6 27 Z 40S ribosomal protein S14-A 4932
124 5M1J 22 O2 40S ribosomal protein S14-A 4932
125 5LZS 65 OO uS11 9986
126 5LZT 66 OO uS11 9986
127 5LZU 65 OO uS11 9986
128 5LZV 66 OO uS11 9986
129 5LZW 66 OO uS11 9986
130 5LZX 66 OO uS11 9986
131 5LZY 64 OO uS11 9986
132 5LZZ 66 OO uS11 9986
133 5T2A 63 AH uS11 5661
134 5T2C 80 AO 40S ribosomal protein S14 9606
135 5LL6 12 Z 40S ribosomal protein S14-A 4932
136 5LKS 74 SO 40S ribosomal protein S14 9606
137 5K0Y 32 j ribosomal protein uS11 9986
138 5JUO 64 LB uS11 (yeast S14) 4932
139 5JUP 64 LB uS11 (yeast S14) 4932
140 5JUS 64 LB uS11 (yeast S14) 4932
141 5JUT 64 LB uS11 (yeast S14) 4932
142 5JUU 64 LB uS11 (yeast S14) 4932
143 5JPQ 29 w uS11 209285
144 5IT7 62 O 40S ribosomal protein S14 28985
145 5IT9 15 O Ribosomal protein uS14 28985
146 5FLX 16 O 40S RIBOSOMAL PROTEIN S14 9986
147 3JAP 18 O uS11 28985
148 3JAQ 18 O uS11 28985
149 3JAM 16 O uS11 28985
150 3JAN 64 SO Ribosomal protein uS11 SEE REMARK 999 9986
151 3JAJ 65 SO Ribosomal protein uS11 SEE REMARK 999 9986
152 3JAG 66 OO uS11 9986
153 3JAH 66 OO uS11 9986
154 3JAI 66 OO uS11 9986
156 4UG0 76 SO 40S RIBOSOMAL PROTEIN S14 9606
157 5AJ0 64 BO 40S ribosomal protein S14 9606
158 4UER 21 K US11 4934
159 4D61 16 O 40S RIBOSOMAL PROTEIN S14 9986
160 4D5L 16 O 40S RIBOSOMAL PROTEIN US11 9986
161 3J81 16 O uS11 28985
162 3J80 12 O uS11 28985
163 3J7P 64 SO Ribosomal protein uS11 9823
164 3J7R 65 SO Ribosomal protein uS11 9823
167 3J7A 16 P 40S ribosomal protein uS11 5833
168 3J77 60 14 40S ribosomal protein S14 4932
169 3J78 60 14 40S ribosomal protein S14 4932
170 3J6X 61 14 40S ribosomal protein S14 4932
171 3J6Y 61 14 40S ribosomal protein S14 4932
173 4V92 17 BO US11 28985
174 4V7E 16 BO 40S ribosomal protein S11 4565
175 4V8Y 23 AO 40S RIBOSOMAL PROTEIN S14-A 4932
176 4V8Z 23 AO 40S RIBOSOMAL PROTEIN S14-A 4932
177 4V6W 5 AO 40S ribosomal protein S14 7227
178 4V6X 5 AO 40S ribosomal protein S14 9606
179 4V8M 16 AH 40S RIBOSOMAL PROTEIN S14 185431
180 3J0O 12 K Ribosomal protein S14 9986
181 3J0L 12 K Ribosomal protein S14 9986
182 4V6I 12 AK 40S ribosomal protein rpS14 (S11p) 4932
183 4V7H 10 AK 40S ribosomal protein S14(A) 5541
184 4V5Z 18 Ak 40S Ribosomal protein S14e 9612
185 4V4B 11 AK 40S ribosomal protein S14-A 4932