Cryo-EM structure of the 90S pre-ribosome (Kre33-Noc4) from Chaetomium thermophilum, state B2

Sequence Similarity Clusters for the Entities in PDB 6RXV

Entity #1 | Chains: UA
Periodic tryptophan protein 2-like protein protein, length: 904 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13207
95 % 3 7 13555
90 % 3 7 13384
70 % 3 7 12682
50 % 3 11 7514
40 % 3 11 7235
30 % 3 11 6796
Entity #10 | Chains: UM
Utp13 protein, length: 912 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13150
95 % 3 7 13448
90 % 3 7 13278
70 % 3 7 12585
50 % 3 7 11494
40 % 3 7 10804
30 % 3 7 9964
Entity #11 | Chains: UN
Utp14 protein, length: 938 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13536
95 % 3 7 13113
90 % 3 7 13015
70 % 3 7 12280
50 % 3 7 11057
40 % 3 7 10194
30 % 3 7 9610
Entity #12 | Chains: UO
Utp15 protein, length: 557 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 12983
95 % 3 7 13149
90 % 3 7 12962
70 % 3 7 12307
50 % 3 7 11233
40 % 3 7 10547
30 % 3 9 7867
Entity #13 | Chains: UQ
Utp17 protein, length: 960 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13306
95 % 3 7 12851
90 % 3 7 13533
70 % 3 7 11889
50 % 3 7 10834
40 % 3 7 10184
30 % 3 7 9426
Entity #14 | Chains: UR
Utp18 protein, length: 618 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 12870
95 % 3 7 13294
90 % 3 7 13108
70 % 3 7 12439
50 % 3 7 11350
40 % 3 7 10669
30 % 3 11 6608
Entity #15 | Chains: UU
Utp21 protein, length: 1049 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 12765
95 % 3 7 12666
90 % 3 7 12493
70 % 3 7 11904
50 % 3 7 10847
40 % 3 7 10195
30 % 3 7 9436
Entity #16 | Chains: UX
Utp24 protein, length: 193 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 8 12345
95 % 3 8 11721
90 % 3 8 11591
70 % 3 8 11078
50 % 3 12 7008
40 % 3 12 6768
30 % 3 12 6369
Entity #17 | Chains: UZ
Utp30 protein, length: 391 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13074
95 % 3 7 13312
90 % 3 7 13126
70 % 3 7 12454
50 % 3 7 11365
40 % 3 7 10677
30 % 3 7 9852
Entity #18 | Chains: CA,CB
Nop1 protein, length: 313 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 5522
95 % 3 7 6325
90 % 3 7 6341
70 % 3 7 6262
50 % 3 11 3534
40 % 3 11 3520
30 % 3 11 3441
Entity #19 | Chains: CC
Nop56 protein, length: 523 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13206
95 % 3 7 13148
90 % 3 7 12961
70 % 3 7 12306
50 % 3 11 7212
40 % 3 14 5446
30 % 3 14 5203
Entity #2 | Chains: UB
Utp2 protein, length: 907 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13828
95 % 3 7 13670
90 % 3 7 13495
70 % 3 7 12793
50 % 3 7 11685
40 % 3 7 10980
30 % 3 7 10136
Entity #20 | Chains: CD
Nop58 protein, length: 582 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13831
95 % 3 7 13681
90 % 3 7 13502
70 % 3 7 12799
50 % 3 7 11692
40 % 3 7 10987
30 % 3 7 10142
Entity #21 | Chains: CE,CF
Snu13 protein, length: 127 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 5505
95 % 3 7 6303
90 % 3 7 6315
70 % 3 7 6244
50 % 12 34 1379
40 % 13 35 1362
30 % 12 34 1456
Entity #22 | Chains: CG
Rrp9 protein, length: 630 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13662
95 % 3 7 12773
90 % 3 7 13181
70 % 3 7 12379
50 % 3 7 11407
40 % 3 7 10614
30 % 3 7 9798
Entity #23 | Chains: CH
RNA 3'-terminal phosphate cyclase-like protein protein, length: 411 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13702
95 % 3 7 13073
90 % 3 7 13263
70 % 3 7 12572
50 % 3 7 11479
40 % 3 7 10793
30 % 3 7 9955
Entity #24 | Chains: CI
Bms1 protein, length: 1163 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13202
95 % 3 7 13545
90 % 3 7 13378
70 % 3 7 12676
50 % 3 7 11586
40 % 3 11 7266
30 % 3 11 6823
Entity #25 | Chains: CJ
Imp3 protein, length: 183 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 8 11058
95 % 3 8 10671
90 % 3 8 10586
70 % 3 8 11540
50 % 3 12 7052
40 % 3 12 6826
30 % 3 12 6406
Entity #26 | Chains: CK
Imp4 protein, length: 297 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 8 11081
95 % 3 8 10451
90 % 3 8 12137
70 % 3 8 11572
50 % 3 11 7542
40 % 3 11 7263
30 % 3 11 6819
Entity #27 | Chains: CL
Mpp10 protein, length: 785 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13133
95 % 3 7 13418
90 % 3 7 13241
70 % 3 7 12543
50 % 3 7 11452
40 % 3 7 10766
30 % 3 7 9935
Entity #28 | Chains: CM
Sof1 protein, length: 446 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13594
95 % 3 7 13235
90 % 3 7 13043
70 % 3 7 12380
50 % 3 7 11299
40 % 3 9 8483
30 % 3 9 7930
Entity #29 | Chains: CN,CO
Emg1 protein, length: 252 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 5396
95 % 3 7 6095
90 % 3 7 6124
70 % 8 17 2374
50 % 8 17 2404
40 % 8 17 2425
30 % 8 17 2453
Entity #3 | Chains: UC
Utp3 protein, length: 648 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 12841
95 % 3 7 12843
90 % 3 7 12657
70 % 3 7 11875
50 % 3 7 10983
40 % 3 7 10324
30 % 3 7 9543
Entity #30 | Chains: CP
KRR1 small subunit processome component protein, length: 322 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 8 9545
95 % 3 8 10194
90 % 3 8 10117
70 % 3 11 7211
50 % 3 11 7115
40 % 3 11 6873
30 % 3 11 6459
Entity #31 | Chains: CQ
Pre-rRNA-processing protein PNO1 protein, length: 259 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13408
95 % 3 7 13425
90 % 3 7 12693
70 % 3 7 12144
50 % 3 7 11003
40 % 3 7 10336
30 % 3 7 9558
Entity #32 | Chains: CR,CS
Kre33 protein, length: 1073 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 8 4192
95 % 3 8 5126
90 % 3 8 5194
70 % 3 8 5144
50 % 3 8 4995
40 % 3 8 4867
30 % 3 8 4697
Entity #33 | Chains: CT
Fcf2 protein, length: 203 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 12738
95 % 3 7 12653
90 % 3 7 12567
70 % 3 7 11855
50 % 3 7 10808
40 % 3 7 10255
30 % 3 7 9490
Entity #34 | Chains: Ca
40S ribosomal protein S1 protein, length: 255 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 5 18549
95 % 3 5 17671
90 % 3 5 17358
70 % 49 89 456
50 % 54 145 354
40 % 56 152 349
30 % 56 152 364
Entity #35 | Chains: Cb
40S ribosomal protein S4 protein, length: 264 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 5 20343
95 % 2 5 18610
90 % 2 5 18278
70 % 53 171 266
50 % 55 181 258
40 % 55 185 263
30 % 59 194 258
Entity #36 | Chains: Cc
40S ribosomal protein s5-like protein protein, length: 212 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13809
95 % 3 7 13623
90 % 3 7 13454
70 % 8 93 647
50 % 57 191 236
40 % 57 191 247
30 % 57 191 262
Entity #37 | Chains: Cd
40S ribosomal protein S6 protein, length: 239 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 5 20342
95 % 2 5 18609
90 % 2 5 18277
70 % 7 83 736
50 % 54 172 301
40 % 54 177 297
30 % 54 177 323
Entity #38 | Chains: Ce
40S ribosomal protein S7 protein, length: 203 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13811
95 % 3 7 13625
90 % 3 7 13456
70 % 3 7 12755
50 % 54 178 277
40 % 54 178 290
30 % 56 181 291
Entity #39 | Chains: Cf
40S ribosomal protein S8 protein, length: 202 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 5 19805
95 % 2 5 17518
90 % 2 5 17376
70 % 48 91 447
50 % 55 180 260
40 % 55 184 267
30 % 55 184 282
Entity #4 | Chains: UD
Utp4 protein, length: 884 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 4 8 9271
95 % 4 8 10154
90 % 4 8 10075
70 % 4 8 9758
50 % 4 8 9092
40 % 4 8 8684
30 % 4 8 8109
Entity #40 | Chains: Cg
40S ribosomal protein s9-like protein protein, length: 190 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13648
95 % 3 7 13332
90 % 3 7 13150
70 % 55 175 253
50 % 57 190 239
40 % 61 198 233
30 % 61 198 249
Entity #41 | Chains: Ch
40S ribosomal protein S13-like protein protein, length: 151 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13454
95 % 3 7 12958
90 % 3 7 12777
70 % 55 180 247
50 % 57 187 243
40 % 61 195 238
30 % 61 196 254
Entity #42 | Chains: Ci
40S ribosomal protein S14-like protein protein, length: 150 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 12833
95 % 3 7 13016
90 % 7 73 809
70 % 57 188 220
50 % 57 189 240
40 % 57 189 252
30 % 57 189 267
Entity #43 | Chains: Cj
40S ribosomal protein S16-like protein protein, length: 143 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13386
95 % 3 7 12821
90 % 3 7 12539
70 % 3 7 12033
50 % 57 182 253
40 % 61 190 249
30 % 61 191 263
Entity #44 | Chains: Ck
40S ribosomal protein S11-like protein protein, length: 161 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 5 20207
95 % 2 5 18365
90 % 2 5 18047
70 % 49 93 435
50 % 56 187 242
40 % 56 187 255
30 % 56 187 269
Entity #45 | Chains: Cm
40S ribosomal protein S22-like protein protein, length: 130 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13796
95 % 3 7 13063
90 % 3 7 13438
70 % 56 191 223
50 % 63 202 215
40 % 63 202 229
30 % 425 763 22
Entity #46 | Chains: Cn
40S ribosomal protein s23-like protein protein, length: 145 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13081
95 % 3 7 13319
90 % 3 7 13138
70 % 57 194 197
50 % 61 204 211
40 % 61 204 227
30 % 61 204 244
Entity #47 | Chains: Co
40S ribosomal protein S24 protein, length: 136 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 5 18989
95 % 2 5 18419
90 % 2 5 18102
70 % 48 93 438
50 % 53 182 268
40 % 53 182 279
30 % 53 182 304
Entity #48 | Chains: Cp
40S ribosomal protein S28-like protein protein, length: 68 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13649
95 % 3 7 13333
90 % 3 7 13342
70 % 55 181 244
50 % 61 192 233
40 % 61 193 242
30 % 61 193 257
Entity #49 | Chains: CU
Faf1 protein, length: 311 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13387
95 % 3 7 12822
90 % 3 7 12640
70 % 3 7 12034
50 % 3 7 10972
40 % 3 7 10315
30 % 3 7 9537
Entity #5 | Chains: UF
Utp6 protein, length: 414 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13242
95 % 3 7 13554
90 % 3 7 13257
70 % 3 7 12681
50 % 3 7 11592
40 % 3 7 10891
30 % 3 7 10047
Entity #50 | Chains: C1
35S ribosomal RNA rna, length: 2352 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
Entity #51 | Chains: C2
U3 snoRNA rna, length: 230 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
Entity #52 | Chains: UV
U3 small nucleolar RNA-associated protein 22 protein, length: 1171 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 4 30533
95 % 1 4 25672
90 % 1 4 24842
70 % 1 4 22653
50 % 1 4 19953
40 % 1 4 18274
30 % 1 4 16400
Entity #53 | Chains: CV
Rrp7 protein, length: 322 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 4 25820
95 % 1 4 26295
90 % 1 4 25215
70 % 1 4 22969
50 % 1 4 20357
40 % 1 4 18500
30 % 1 4 16591
Entity #54 | Chains: CW
Ribosome biogenesis protein ENP2 protein, length: 668 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 4 28887
95 % 2 4 23406
90 % 2 4 22733
70 % 2 4 20806
50 % 2 4 18421
40 % 2 4 16926
30 % 2 4 15269
Entity #55 | Chains: UT
Utp20 protein, length: 2612 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 4 24042
95 % 2 4 25917
90 % 2 4 25086
70 % 2 4 22858
50 % 2 4 18738
40 % 2 4 18417
30 % 2 4 15507
Entity #56 | Chains: UH
Utp8 protein, length: 930 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 6 16064
95 % 3 6 17074
90 % 3 6 16775
70 % 3 6 15684
50 % 3 6 14155
40 % 3 6 13153
30 % 3 6 12005
Entity #57 | Chains: UE,UI
Utp5 protein, length: 410 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 6 7234
95 % 3 6 7825
90 % 3 6 7797
70 % 3 6 7603
50 % 3 6 7151
40 % 3 6 6904
30 % 3 6 6481
Entity #58 | Chains: US
Noc4 protein, length: 549 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 6 17319
95 % 3 6 15703
90 % 3 6 14423
70 % 3 6 13894
50 % 3 6 12621
40 % 3 6 11790
30 % 3 6 11255
Entity #59 | Chains: Cl
Rps18 protein, length: 156 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 6 16063
95 % 3 6 17073
90 % 3 6 16774
70 % 55 173 260
50 % 57 182 255
40 % 61 192 246
30 % 61 192 261
Entity #6 | Chains: UG
Utp7 protein, length: 558 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13827
95 % 3 7 13669
90 % 3 7 13494
70 % 3 7 12792
50 % 3 7 11684
40 % 3 9 8738
30 % 3 9 7626
Entity #60 | Chains: CX
Enp1 protein, length: 480 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 6 16062
95 % 3 6 16941
90 % 3 6 16773
70 % 3 6 15581
50 % 3 6 14154
40 % 3 6 13152
30 % 4 15 5117
Entity #61 | Chains: CY
U3 small nucleolar ribonucleoprotein protein lcp5-like protein protein, length: 381 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 3 34424
95 % 2 3 26463
90 % 2 3 26181
70 % 2 3 23305
50 % 2 3 20485
40 % 2 3 19149
30 % 2 3 17174
Entity #62 | Chains: CZ
Bfr2 protein, length: 609 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 4 27677
95 % 2 4 21729
90 % 2 4 21200
70 % 2 4 19514
50 % 2 4 17379
40 % 2 4 16019
30 % 2 4 14492
Entity #63 | Chains: UP
Utp16 protein, length: 364 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 6 16132
95 % 3 6 13801
90 % 3 6 13621
70 % 3 6 12907
50 % 3 6 11792
40 % 3 6 11076
30 % 3 6 10218
Entity #7 | Chains: UJ
UTP10 protein, length: 1802 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 8 10579
95 % 3 8 11552
90 % 3 8 11428
70 % 3 8 10929
50 % 3 8 10065
40 % 3 8 9565
30 % 3 8 8858
Entity #8 | Chains: UK
U3 small nucleolar RNA-associated protein 11 protein, length: 270 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13428
95 % 3 7 12909
90 % 3 7 12729
70 % 3 7 12101
50 % 3 7 11038
40 % 3 7 10373
30 % 3 7 9592
Entity #9 | Chains: UL
Utp12 protein, length: 962 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 12842
95 % 3 7 13170
90 % 3 7 12658
70 % 3 7 12043
50 % 3 7 10984
40 % 3 11 7038
30 % 3 11 6609


In the table for each entity, view a list of similar sequences by selecting the link associated with the percentage cutoff.

View more detailed documentation on the redundancy reduction and sequence clustering procedure used by RCSB PDB.

You can also use the structure comparison tool to compare any 2 given structures

ACTION - (A) Select for download / view details OR (B) Select two chains for comparison
Rank PDB ID Entity ID Chains Description Details Taxonomy EC Number
1 4V88 16 AO, CO 40S ribosomal protein S14-A 4932
2 4U4R 16 C4, c4 40S ribosomal protein S14-A 4932
3 4U3U 16 C4, c4 40S ribosomal protein S14-A 4932
4 5TBW 63 P, c4 40S ribosomal protein S14-B 4932
5 4U3M 16 C4, c4 40S ribosomal protein S14-A 4932
6 4U3N 16 C4, c4 40S ribosomal protein S14-A 4932
7 4U52 16 C4, c4 40S ribosomal protein S14-A 4932
8 4U4Q 16 C4, c4 40S ribosomal protein S14-A 4932
9 4U6F 16 C4, c4 40S ribosomal protein S14-A 4932
10 4U4U 16 C4, c4 40S ribosomal protein S14-A 4932
11 4U4Z 16 C4, c4 40S ribosomal protein S14-A 4932
12 4U4Y 16 C4, c4 40S ribosomal protein S14-A 4932
13 4U4N 16 C4, c4 40S ribosomal protein S14-A 4932
14 4U55 16 C4, c4 40S ribosomal protein S14-A 4932
15 5DAT 16 C4, c4 40S ribosomal protein S14-A 4932
16 5I4L 16 C4, c4 40S ribosomal protein S14-B 4932
17 4U51 16 C4, c4 40S ribosomal protein S14-A 4932
18 6HHQ 62 P, c4 40S ribosomal protein S14-B 4932
19 5OBM 60 C4, c4 40S ribosomal protein S14-B 4932
20 4U53 16 C4, c4 40S ribosomal protein S14-A 4932
21 5ON6 64 P, c4 40S ribosomal protein S14-B 4932
22 4U50 16 C4, c4 40S ribosomal protein S14-A 4932
23 5NDV 60 C4, c4 40S ribosomal protein S14-B 4932
24 5LYB 16 C4, c4 40S Ribosomal Protein S14 4932
25 4U56 16 C4, c4 40S ribosomal protein S14-A 4932
26 5TGA 16 C4, c4 40S ribosomal protein S14-B 4932
27 5MEI 63 P, c4 40S ribosomal protein S14-B 4932
28 5FCJ 16 C4, c4 40S ribosomal protein S14-A (UNK) residues correspond to residues that aren't well resolved, and for which side-chains could not be modeled. (UNK)s were substituted in the original sequence of the crystallized protein. Remaining misalignments result from differences in the distribution of (UNK)s between the two instances of the molecule in the structure. Here is the original sequence ot the crystallized protein : SNVVQARDNSQVFGVARIYASFNDTFVHVTDLSGKETIARVTGGMKVKADRDESSPYAAMLAAQDVAAKCKEVGITAVHV KIRATGGTRTKTPGPGGQAALRALARSGLRIGRIEDVTPVPSDSTRKKGGRRGRRL 4932
29 4U4O 16 C4, c4 40S ribosomal protein S14-A 4932
30 5DGV 16 C4, c4 40S ribosomal protein S14-A 4932
31 5DGE 16 C4, c4 40S ribosomal protein S14-A 4932
32 5NDW 9 C4, c4 40S ribosomal protein S14-B 4932
34 5NDG 16 C4, c4 40S ribosomal protein S14-A 4932
35 5FCI 16 C4, c4 40S ribosomal protein S14-A (UNK) residues correspond to residues that aren't well resolved, and for which side-chains could not be modeled. (UNK)s were substituted in the original sequence of the crystallized protein. Remaining misalignments result from differences in the distribution of (UNK)s between the two instances of the molecule in the structure. Here is the original sequence ot the crystallized protein : SNVVQARDNSQVFGVARIYASFNDTFVHVTDLSGKETIARVTGGMKVKADRDESSPYAAMLAAQDVAAKCKEVGITAVHV KIRATGGTRTKTPGPGGQAALRALARSGLRIGRIEDVTPVPSDSTRKKGGRRGRRL 4932
36 5DC3 16 C4, c4 40S ribosomal protein S14-A 4932
37 5DGF 16 C4, c4 40S ribosomal protein S14-A 4932
38 4V5O 20 AK, BK RPS14E 5911
39 5TGM 16 C4, c4 40S ribosomal protein S14-A 4932
40 4V7R 9 AH, CH 40S ribosomal protein S14-A 4932
41 5VYC 15 O1, O2, O3, O4, O5, O6 40S ribosomal protein S14 9606
42 4KZZ 15 O 40S Ribosomal Protein S14 9986
43 4KZX 15 O 40S ribosomal protein S14 9986
44 4KZY 15 O 40S Ribosomal Protein S14 9986
45 6Y7C 14 O 40S ribosomal protein S14-A 4932
46 6UZ7 62 O 40S ribosomal protein S14 28985
47 6T83 17 Ob, p 40S ribosomal protein S14-A 4932
48 6T7T 19 SO 40S ribosomal protein S14-B 4932
49 6T7I 17 SO 40S ribosomal protein S14-A 4932
50 6T4Q 16 SO 40S ribosomal protein S14-B 4932
51 6SV4 33 Z, Zb, Zc 40S ribosomal protein S14-A 4932
52 6SNT 17 O 40S ribosomal protein S14-A 4932
53 6SGC 16 P1 uS11 9986
54 6S47 60 BP 40S ribosomal protein S14-A 4932
55 6RXT 39 Ci 40S ribosomal protein S14-like protein 209285
56 6RXU 42 Ci 40S ribosomal protein S14-like protein 209285
57 6RXV 42 Ci 40S ribosomal protein S14-like protein 209285
58 6RXX 24 Ci 40S ribosomal protein S14-like protein 209285
59 6RXY 38 Ci 40S ribosomal protein S14-like protein 209285
60 6RXZ 41 Ci 40S ribosomal protein S14-like protein 209285
61 6P5I 16 P uS11 9986
62 6P5J 16 P uS11 9986
63 6P5K 62 P uS11 9986
64 6P5N 62 P uS11 9986
65 6P4G 16 P uS11 9986
66 6P4H 17 P uS11 9986
67 6OM7 28 SO 40S ribosomal protein S14 9606
68 6OLZ 61 BO 40S ribosomal protein S14 9606
69 6OM0 28 SO 40S ribosomal protein S14 9606
70 6OLE 28 SO 40S ribosomal protein S14 9606
71 6OLF 28 SO 40S ribosomal protein S14 9606
72 6OLG 64 BO 40S ribosomal protein S14 9606
73 6OLI 28 SO 40S ribosomal protein S14 9606
74 6OKK 16 P 40S ribosomal protein S11 5833
75 6RBD 27 O 40S ribosomal protein S14-A 4932
76 6RBE 12 O 40S ribosomal protein S14-A 4932
77 6R7Q 13 MM uS11 9986
78 6R6G 36 MM 40S ribosomal protein S14 9986
79 6R6P 62 MM uS11 9986
80 6R5Q 66 MM uS11 9986
81 6QZP 75 SO 40S ribosomal protein S14 9606
82 6Q8Y 81 Z 40S ribosomal protein S14-B 4932
83 6I7O 33 Z, Zb 40S ribosomal protein S14-B 4932
84 6IP5 74 3L 40S ribosomal protein S14 9606
85 6IP6 73 3L 40S ribosomal protein S14 9606
86 6IP8 73 3L 40S ribosomal protein S14 9606
87 6MTB 65 OO 40S ribosomal protein S14 9986
88 6MTC 64 OO 40S ribosomal protein S14 9986
89 6MTD 66 OO uS11 9986
90 6MTE 65 OO uS11 9986
91 6HCQ 19 P2 uS11 9986
92 6HCJ 19 P2 uS11 9986
93 6HCM 16 P1 uS11 9986
94 6HCF 16 P1 uS11 9986
95 6GZ3 31 BO ribosomal protein uS11 9986
96 6GZ4 34 BO ribosomal protein uS11 9986
97 6GZ5 31 BO ribosomal protein uS11 9986
98 6GSM 18 O 40S ribosomal protein S14 28985
99 6GSN 38 O 40S ribosomal protein S14 28985
100 6GQV 62 AE 40S ribosomal protein S14-B 4932
101 6GQ1 62 AE 40S ribosomal protein S14-B 4932
102 6GQB 62 AE 40S ribosomal protein S14-B 4932
103 6D9J 64 PP uS11 9986
104 6D90 65 PP uS11 9986
105 6G5H 12 O 40S ribosomal protein S14 9606
106 6G5I 16 O 40S ribosomal protein S14 9606
107 6G4S 27 O 40S ribosomal protein S14 9606
108 6G4W 23 O 40S ribosomal protein S14 9606
109 6G51 13 O 40S ribosomal protein S14 9606
110 6G53 13 O 40S ribosomal protein S14 9606
111 6G18 23 O 40S ribosomal protein S14 9606
112 6FYX 18 O 40S ribosomal protein S14 28985
113 6FYY 18 O 40S ribosomal protein S14 28985
114 6FEC 38 j 40S ribosomal protein S14 9606
115 6FAI 25 O 40S ribosomal protein S14-A 4932
116 6EML 22 Z 40S ribosomal protein S14-A 4932
117 6EK0 75 SO 40S ribosomal protein S14 9606
118 6AZ1 15 O ribosomal protein S11 5661
119 5OQL 42 t 40S ribosomal protein S14-like protein 209285
120 5OPT 14 V 40S ribosomal protein S14, putative 5693
121 5WLC 40 NG rpS14_uS11 4932
122 5XXU 16 O Ribosomal protein uS11 5811
123 5OA3 19 O 40S ribosomal protein S14 9606
124 5WYJ 45 SP 40S ribosomal protein S14-A 4932
125 5WYK 41 SP 40S ribosomal protein S14-A 4932
126 5MC6 27 Z 40S ribosomal protein S14-A 4932
127 5M1J 22 O2 40S ribosomal protein S14-A 4932
128 5LZS 65 OO uS11 9986
129 5LZT 66 OO uS11 9986
130 5LZU 65 OO uS11 9986
131 5LZV 66 OO uS11 9986
132 5LZW 66 OO uS11 9986
133 5LZX 66 OO uS11 9986
134 5LZY 64 OO uS11 9986
135 5LZZ 66 OO uS11 9986
136 5T2A 63 AH uS11 5661
137 5T2C 80 AO 40S ribosomal protein S14 9606
138 5LL6 12 Z 40S ribosomal protein S14-A 4932
139 5LKS 74 SO 40S ribosomal protein S14 9606
140 5K0Y 32 j ribosomal protein uS11 9986
141 5JUO 64 LB uS11 (yeast S14) 4932
142 5JUP 64 LB uS11 (yeast S14) 4932
143 5JUS 64 LB uS11 (yeast S14) 4932
144 5JUT 64 LB uS11 (yeast S14) 4932
145 5JUU 64 LB uS11 (yeast S14) 4932
146 5JPQ 29 w uS11 209285
147 5IT7 62 O 40S ribosomal protein S14 28985
148 5IT9 15 O Ribosomal protein uS14 28985
149 5FLX 16 O 40S RIBOSOMAL PROTEIN S14 9986
150 3JAP 18 O uS11 28985
151 3JAQ 18 O uS11 28985
152 3JAM 16 O uS11 28985
153 3JAN 64 SO Ribosomal protein uS11 SEE REMARK 999 9986
154 3JAJ 65 SO Ribosomal protein uS11 SEE REMARK 999 9986
155 3JAG 66 OO uS11 9986
156 3JAH 66 OO uS11 9986
157 3JAI 66 OO uS11 9986
159 4UG0 76 SO 40S RIBOSOMAL PROTEIN S14 9606
160 5AJ0 64 BO 40S ribosomal protein S14 9606
161 4UER 21 K US11 4934
162 4D61 16 O 40S RIBOSOMAL PROTEIN S14 9986
163 4D5L 16 O 40S RIBOSOMAL PROTEIN US11 9986
164 3J81 16 O uS11 28985
165 3J80 12 O uS11 28985
166 3J7P 64 SO Ribosomal protein uS11 9823
167 3J7R 65 SO Ribosomal protein uS11 9823
170 3J7A 16 P 40S ribosomal protein uS11 5833
171 3J77 60 14 40S ribosomal protein S14 4932
172 3J78 60 14 40S ribosomal protein S14 4932
173 3J6X 61 14 40S ribosomal protein S14 4932
174 3J6Y 61 14 40S ribosomal protein S14 4932
176 4V92 17 BO US11 28985
177 4V7E 16 BO 40S ribosomal protein S11 4565
178 4V8Y 23 AO 40S RIBOSOMAL PROTEIN S14-A 4932
179 4V8Z 23 AO 40S RIBOSOMAL PROTEIN S14-A 4932
180 4V6W 5 AO 40S ribosomal protein S14 7227
181 4V6X 5 AO 40S ribosomal protein S14 9606
182 4V8M 16 AH 40S RIBOSOMAL PROTEIN S14 185431
183 3J0O 12 K Ribosomal protein S14 9986
184 3J0L 12 K Ribosomal protein S14 9986
185 4V6I 12 AK 40S ribosomal protein rpS14 (S11p) 4932
186 4V7H 10 AK 40S ribosomal protein S14(A) 5541
187 4V5Z 18 Ak 40S Ribosomal protein S14e 9612
188 4V4B 11 AK 40S ribosomal protein S14-A 4932