Cryo-EM structure of the 90S pre-ribosome (Kre33-Noc4) from Chaetomium thermophilum, state B2

Sequence Similarity Clusters for the Entities in PDB 6RXV

Entity #1 | Chains: UA
Periodic tryptophan protein 2-like protein protein, length: 904 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 14883
95 % 3 7 14677
90 % 3 7 14466
70 % 3 7 13610
50 % 17 25 3459
40 % 17 25 3432
30 % 17 25 3385
Entity #10 | Chains: UM
Utp13 protein, length: 912 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 14658
95 % 3 7 14241
90 % 3 7 14032
70 % 3 7 13208
50 % 3 7 12041
40 % 3 7 11304
30 % 3 7 10410
Entity #11 | Chains: UN
Utp14 protein, length: 938 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 14399
95 % 3 7 13728
90 % 3 7 13534
70 % 3 7 12755
50 % 3 7 11619
40 % 3 7 10909
30 % 3 7 10068
Entity #12 | Chains: UO
Utp15 protein, length: 557 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 14141
95 % 3 7 14432
90 % 3 7 14232
70 % 3 7 13376
50 % 3 7 12189
40 % 3 7 11449
30 % 16 22 3743
Entity #13 | Chains: UQ
Utp17 protein, length: 960 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 14400
95 % 3 7 13729
90 % 3 7 13535
70 % 3 7 12756
50 % 3 7 11620
40 % 3 7 10910
30 % 3 7 10069
Entity #14 | Chains: UR
Utp18 protein, length: 618 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 14140
95 % 3 7 14431
90 % 3 7 14231
70 % 3 7 13375
50 % 3 7 12188
40 % 3 7 11448
30 % 16 24 3403
Entity #15 | Chains: UU
Utp21 protein, length: 1049 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13969
95 % 3 7 14088
90 % 3 7 13868
70 % 3 7 13067
50 % 3 7 11917
40 % 3 7 11177
30 % 3 7 10302
Entity #16 | Chains: UX
Utp24 protein, length: 193 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 8 13288
95 % 3 8 12505
90 % 3 8 12376
70 % 3 8 11773
50 % 17 26 3268
40 % 17 26 3249
30 % 17 26 3209
Entity #17 | Chains: UZ
Utp30 protein, length: 391 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13721
95 % 3 7 13580
90 % 3 7 13398
70 % 3 7 12649
50 % 3 7 11514
40 % 3 7 10809
30 % 3 7 9967
Entity #18 | Chains: CA,CB
Nop1 protein, length: 313 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 5936
95 % 3 7 6657
90 % 3 7 6677
70 % 3 7 6592
50 % 16 24 1667
40 % 16 24 1699
30 % 16 24 1735
Entity #19 | Chains: CC
Nop56 protein, length: 523 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 14273
95 % 3 7 14087
90 % 3 7 13867
70 % 3 7 13392
50 % 16 24 3503
40 % 29 41 2013
30 % 29 41 2031
Entity #2 | Chains: UB
Utp2 protein, length: 907 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 14882
95 % 3 7 14676
90 % 3 7 14465
70 % 3 7 13609
50 % 3 7 12417
40 % 3 7 11645
30 % 3 7 10712
Entity #20 | Chains: CD
Nop58 protein, length: 582 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 14447
95 % 3 7 14176
90 % 3 7 13957
70 % 3 7 13133
50 % 3 7 11976
40 % 3 7 11237
30 % 3 7 10349
Entity #21 | Chains: CE,CF
Snu13 protein, length: 127 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 5711
95 % 3 7 6802
90 % 3 7 6812
70 % 3 7 6715
50 % 25 47 959
40 % 26 48 963
30 % 25 47 1028
Entity #22 | Chains: CG
Rrp9 protein, length: 630 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 14707
95 % 3 7 14342
90 % 3 7 13417
70 % 3 7 12663
50 % 3 7 11526
40 % 3 7 10822
30 % 3 7 9981
Entity #23 | Chains: CH
RNA 3'-terminal phosphate cyclase-like protein protein, length: 411 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 14624
95 % 3 7 14177
90 % 3 7 13958
70 % 3 7 13134
50 % 3 7 11977
40 % 3 7 11238
30 % 3 7 10350
Entity #24 | Chains: CI
Bms1 protein, length: 1163 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 14706
95 % 3 7 13602
90 % 3 7 14135
70 % 3 7 13301
50 % 3 7 12123
40 % 18 26 3310
30 % 18 26 3282
Entity #25 | Chains: CJ
Imp3 protein, length: 183 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 8 13289
95 % 3 8 12829
90 % 3 8 12674
70 % 3 8 12033
50 % 17 26 3205
40 % 17 26 3189
30 % 17 26 3152
Entity #26 | Chains: CK
Imp4 protein, length: 297 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 8 12978
95 % 3 8 12376
90 % 3 8 12249
70 % 3 8 11677
50 % 18 26 3329
40 % 18 26 3231
30 % 18 26 3273
Entity #27 | Chains: CL
Mpp10 protein, length: 785 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 14120
95 % 3 7 14390
90 % 3 7 14185
70 % 3 7 13332
50 % 3 7 12152
40 % 3 7 11414
30 % 3 7 10502
Entity #28 | Chains: CM
Sof1 protein, length: 446 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13970
95 % 3 7 14089
90 % 3 7 13870
70 % 3 7 13068
50 % 3 7 11919
40 % 15 21 4092
30 % 15 21 3988
Entity #29 | Chains: CN,CO
Emg1 protein, length: 252 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 5542
95 % 3 7 6730
90 % 3 7 6743
70 % 23 32 1261
50 % 23 32 1305
40 % 23 32 1346
30 % 23 32 1378
Entity #3 | Chains: UC
Utp3 protein, length: 648 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 14854
95 % 3 7 14625
90 % 3 7 14423
70 % 3 7 13569
50 % 3 7 12379
40 % 3 7 11607
30 % 18 23 3608
Entity #30 | Chains: CP
KRR1 small subunit processome component protein, length: 322 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 8 9658
95 % 3 8 10462
90 % 3 8 10376
70 % 10 18 4659
50 % 10 18 4558
40 % 10 18 4430
30 % 10 18 4324
Entity #31 | Chains: CQ
Pre-rRNA-processing protein PNO1 protein, length: 259 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 14850
95 % 3 7 14621
90 % 3 7 14417
70 % 3 7 13564
50 % 3 7 12374
40 % 3 7 11602
30 % 3 7 10677
Entity #32 | Chains: CR,CS
Kre33 protein, length: 1073 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 8 4900
95 % 3 8 5525
90 % 3 8 5561
70 % 3 8 5846
50 % 11 16 2682
40 % 11 16 2668
30 % 11 16 2660
Entity #33 | Chains: CT
Fcf2 protein, length: 203 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 14469
95 % 3 7 13888
90 % 3 7 13687
70 % 3 7 12893
50 % 3 7 11748
40 % 3 7 11026
30 % 3 7 10609
Entity #34 | Chains: Ca
40S ribosomal protein S1 protein, length: 255 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 5 22096
95 % 3 5 20293
90 % 3 5 19841
70 % 73 113 421
50 % 107 199 284
40 % 107 203 287
30 % 107 203 298
Entity #35 | Chains: Cb
40S ribosomal protein S4 protein, length: 264 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 5 20065
95 % 2 5 18406
90 % 2 5 18689
70 % 108 226 235
50 % 109 238 236
40 % 111 241 233
30 % 118 260 232
Entity #36 | Chains: Cc
40S ribosomal protein s5-like protein protein, length: 212 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 14851
95 % 3 7 14622
90 % 3 7 14418
70 % 38 123 522
50 % 114 248 218
40 % 114 248 225
30 % 114 259 233
Entity #37 | Chains: Cd
40S ribosomal protein S6 protein, length: 239 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 5 22094
95 % 2 5 20292
90 % 2 5 19840
70 % 2 5 18331
50 % 109 226 251
40 % 109 230 249
30 % 109 230 257
Entity #38 | Chains: Ce
40S ribosomal protein S7 protein, length: 203 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 14471
95 % 3 7 13890
90 % 3 7 13689
70 % 3 7 12901
50 % 110 234 242
40 % 110 234 245
30 % 112 237 245
Entity #39 | Chains: Cf
40S ribosomal protein S8 protein, length: 202 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 5 20064
95 % 2 5 19063
90 % 2 5 18687
70 % 74 117 401
50 % 110 235 235
40 % 110 239 236
30 % 110 239 243
Entity #4 | Chains: UD
Utp4 protein, length: 884 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 4 8 10367
95 % 4 8 10619
90 % 4 8 10838
70 % 4 8 10196
50 % 4 8 9409
40 % 4 8 9036
30 % 4 8 8438
Entity #40 | Chains: Cg
40S ribosomal protein s9-like protein protein, length: 190 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13875
95 % 3 7 13872
90 % 3 7 13669
70 % 111 231 232
50 % 114 247 220
40 % 121 258 214
30 % 121 258 225
Entity #41 | Chains: Ch
40S ribosomal protein S13-like protein protein, length: 151 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 14470
95 % 3 7 13889
90 % 3 7 13688
70 % 112 237 226
50 % 114 244 226
40 % 121 256 217
30 % 121 256 226
Entity #42 | Chains: Ci
40S ribosomal protein S14-like protein protein, length: 150 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 14675
95 % 3 7 13796
90 % 36 102 640
70 % 112 243 216
50 % 112 244 225
40 % 112 244 230
30 % 112 244 236
Entity #43 | Chains: Cj
40S ribosomal protein S16-like protein protein, length: 143 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 14117
95 % 3 7 14063
90 % 3 7 14104
70 % 3 7 13041
50 % 111 236 234
40 % 118 247 226
30 % 118 248 234
Entity #44 | Chains: Ck
40S ribosomal protein S11-like protein protein, length: 161 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 5 21691
95 % 2 5 19669
90 % 2 5 19259
70 % 75 119 387
50 % 112 243 227
40 % 112 243 231
30 % 112 243 239
Entity #45 | Chains: Cm
40S ribosomal protein S22-like protein protein, length: 130 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 14505
95 % 3 7 13754
90 % 3 7 13560
70 % 112 247 217
50 % 122 261 201
40 % 122 265 209
30 % 572 915 20
Entity #46 | Chains: Cn
40S ribosomal protein s23-like protein protein, length: 145 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 14343
95 % 3 7 13736
90 % 3 7 13543
70 % 114 257 206
50 % 121 264 193
40 % 121 264 201
30 % 121 264 216
Entity #47 | Chains: Co
40S ribosomal protein S24 protein, length: 136 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 5 21690
95 % 2 5 19668
90 % 2 5 19258
70 % 2 5 17806
50 % 108 237 239
40 % 109 238 242
30 % 109 238 251
Entity #48 | Chains: Cp
40S ribosomal protein S28-like protein protein, length: 68 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13871
95 % 3 7 13860
90 % 3 7 13662
70 % 111 237 225
50 % 120 251 217
40 % 120 252 222
30 % 120 252 231
Entity #49 | Chains: CU
Faf1 protein, length: 311 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13872
95 % 3 7 13861
90 % 3 7 14202
70 % 3 7 12875
50 % 3 7 11721
40 % 3 7 11007
30 % 3 7 10156
Entity #5 | Chains: UF
Utp6 protein, length: 414 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 14881
95 % 3 7 14675
90 % 3 7 14187
70 % 3 7 13336
50 % 3 7 12416
40 % 3 7 11644
30 % 3 7 10505
Entity #50 | Chains: C1
35S ribosomal RNA rna, length: 2352 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
Entity #51 | Chains: C2
U3 snoRNA rna, length: 230 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
Entity #52 | Chains: UV
U3 small nucleolar RNA-associated protein 22 protein, length: 1171 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 4 32739
95 % 1 4 27878
90 % 1 4 26898
70 % 1 4 24402
50 % 1 4 21403
40 % 1 4 19576
30 % 1 4 17528
Entity #53 | Chains: CV
Rrp7 protein, length: 322 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 4 25723
95 % 1 4 27485
90 % 1 4 24607
70 % 1 4 22372
50 % 1 4 19757
40 % 1 4 18152
30 % 1 4 16287
Entity #54 | Chains: CW
Ribosome biogenesis protein ENP2 protein, length: 668 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 4 28994
95 % 2 4 22483
90 % 2 4 21872
70 % 2 4 21962
50 % 2 4 19423
40 % 2 4 16461
30 % 2 4 16030
Entity #55 | Chains: UT
Utp20 protein, length: 2612 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 4 30776
95 % 2 4 23071
90 % 2 4 24126
70 % 2 4 21963
50 % 2 4 17850
40 % 2 4 17856
30 % 2 4 16031
Entity #56 | Chains: UH
Utp8 protein, length: 930 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 6 17279
95 % 3 6 18343
90 % 3 6 17982
70 % 3 6 16621
50 % 3 6 14959
40 % 3 6 13881
30 % 3 6 12633
Entity #57 | Chains: UE,UI
Utp5 protein, length: 410 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 6 7425
95 % 3 6 8039
90 % 3 6 8033
70 % 3 6 7446
50 % 3 6 7386
40 % 3 6 7118
30 % 3 6 6719
Entity #58 | Chains: US
Noc4 protein, length: 549 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 6 19554
95 % 3 6 16854
90 % 3 6 17874
70 % 3 6 16525
50 % 3 6 14873
40 % 3 6 13807
30 % 3 6 12564
Entity #59 | Chains: Cl
Rps18 protein, length: 156 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 6 17885
95 % 3 6 15691
90 % 3 6 15430
70 % 107 224 236
50 % 109 233 237
40 % 116 246 227
30 % 116 246 235
Entity #6 | Chains: UG
Utp7 protein, length: 558 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 14195
95 % 3 7 14547
90 % 3 7 14342
70 % 3 7 13488
50 % 3 7 12300
40 % 15 21 4090
30 % 15 21 3986
Entity #60 | Chains: CX
Enp1 protein, length: 480 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 6 17348
95 % 3 6 15315
90 % 3 6 14599
70 % 3 6 13731
50 % 3 6 12522
40 % 3 6 11742
30 % 18 29 2905
Entity #61 | Chains: CY
U3 small nucleolar ribonucleoprotein protein lcp5-like protein protein, length: 381 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 3 37318
95 % 2 3 29296
90 % 2 3 28204
70 % 2 3 25511
50 % 2 3 22323
40 % 2 3 20400
30 % 2 3 18266
Entity #62 | Chains: CZ
Bfr2 protein, length: 609 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 4 27728
95 % 2 4 20677
90 % 2 4 20187
70 % 2 4 18635
50 % 2 4 16694
40 % 2 4 15481
30 % 2 4 14035
Entity #63 | Chains: UP
Utp16 protein, length: 364 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 6 18523
95 % 3 6 16924
90 % 3 6 16392
70 % 3 6 15475
50 % 3 6 13972
40 % 3 6 12883
30 % 3 6 11768
Entity #7 | Chains: UJ
UTP10 protein, length: 1802 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 8 12514
95 % 3 8 11658
90 % 3 8 11529
70 % 3 8 11053
50 % 3 8 10236
40 % 3 8 9740
30 % 3 8 9002
Entity #8 | Chains: UK
U3 small nucleolar RNA-associated protein 11 protein, length: 270 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 14196
95 % 3 7 14548
90 % 3 7 14343
70 % 3 7 13489
50 % 3 7 12301
40 % 3 7 11543
30 % 3 7 10623
Entity #9 | Chains: UL
Utp12 protein, length: 962 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 14853
95 % 3 7 14624
90 % 3 7 14422
70 % 3 7 13568
50 % 3 7 12378
40 % 17 25 3325
30 % 17 25 3321


In the table for each entity, view a list of similar sequences by selecting the link associated with the percentage cutoff.

View more detailed documentation on the redundancy reduction and sequence clustering procedure used by RCSB PDB.

You can also use the structure comparison tool to compare any 2 given structures

ACTION - (A) Select for download / view details OR (B) Select two chains for comparison
Rank PDB ID Entity ID Chains Description Details Taxonomy EC Number
1 4V88 16 AO, CO 40S ribosomal protein S14-A 4932
2 4U4R 16 C4, c4 40S ribosomal protein S14-A 4932
3 4U3U 16 C4, c4 40S ribosomal protein S14-A 4932
4 5TBW 63 P, c4 40S ribosomal protein S14-B 4932
5 4U3M 16 C4, c4 40S ribosomal protein S14-A 4932
6 4U3N 16 C4, c4 40S ribosomal protein S14-A 4932
7 4U52 16 C4, c4 40S ribosomal protein S14-A 4932
8 4U4Q 16 C4, c4 40S ribosomal protein S14-A 4932
9 4U6F 16 C4, c4 40S ribosomal protein S14-A 4932
10 4U4U 16 C4, c4 40S ribosomal protein S14-A 4932
11 4U4Z 16 C4, c4 40S ribosomal protein S14-A 4932
12 4U4Y 16 C4, c4 40S ribosomal protein S14-A 4932
13 4U4N 16 C4, c4 40S ribosomal protein S14-A 4932
14 4U55 16 C4, c4 40S ribosomal protein S14-A 4932
15 5DAT 16 C4, c4 40S ribosomal protein S14-A 4932
16 5I4L 16 C4, c4 40S ribosomal protein S14-B 4932
17 4U51 16 C4, c4 40S ribosomal protein S14-A 4932
18 6HHQ 62 P, c4 40S ribosomal protein S14-B 4932
19 5OBM 60 C4, c4 40S ribosomal protein S14-B 4932
20 4U53 16 C4, c4 40S ribosomal protein S14-A 4932
21 5ON6 64 P, c4 40S ribosomal protein S14-B 4932
22 4U50 16 C4, c4 40S ribosomal protein S14-A 4932
23 5NDV 60 C4, c4 40S ribosomal protein S14-B 4932
24 5LYB 16 C4, c4 40S Ribosomal Protein S14 4932
25 4U56 16 C4, c4 40S ribosomal protein S14-A 4932
26 5TGA 16 C4, c4 40S ribosomal protein S14-B 4932
27 5MEI 63 P, c4 40S ribosomal protein S14-B 4932
28 5FCJ 16 C4, c4 40S ribosomal protein S14-A (UNK) residues correspond to residues that aren't well resolved, and for which side-chains could not be modeled. (UNK)s were substituted in the original sequence of the crystallized protein. Remaining misalignments result from differences in the distribution of (UNK)s between the two instances of the molecule in the structure. Here is the original sequence ot the crystallized protein : SNVVQARDNSQVFGVARIYASFNDTFVHVTDLSGKETIARVTGGMKVKADRDESSPYAAMLAAQDVAAKCKEVGITAVHV KIRATGGTRTKTPGPGGQAALRALARSGLRIGRIEDVTPVPSDSTRKKGGRRGRRL 4932
29 4U4O 16 C4, c4 40S ribosomal protein S14-A 4932
30 5DGV 16 C4, c4 40S ribosomal protein S14-A 4932
31 5DGE 16 C4, c4 40S ribosomal protein S14-A 4932
32 5NDW 9 C4, c4 40S ribosomal protein S14-B 4932
34 5NDG 16 C4, c4 40S ribosomal protein S14-A 4932
35 5FCI 16 C4, c4 40S ribosomal protein S14-A (UNK) residues correspond to residues that aren't well resolved, and for which side-chains could not be modeled. (UNK)s were substituted in the original sequence of the crystallized protein. Remaining misalignments result from differences in the distribution of (UNK)s between the two instances of the molecule in the structure. Here is the original sequence ot the crystallized protein : SNVVQARDNSQVFGVARIYASFNDTFVHVTDLSGKETIARVTGGMKVKADRDESSPYAAMLAAQDVAAKCKEVGITAVHV KIRATGGTRTKTPGPGGQAALRALARSGLRIGRIEDVTPVPSDSTRKKGGRRGRRL 4932
36 5DC3 16 C4, c4 40S ribosomal protein S14-A 4932
37 5DGF 16 C4, c4 40S ribosomal protein S14-A 4932
38 4V5O 20 AK, BK RPS14E 5911
39 5TGM 16 C4, c4 40S ribosomal protein S14-A 4932
40 4V7R 9 AH, CH 40S ribosomal protein S14-A 4932
41 5VYC 15 O1, O2, O3, O4, O5, O6 40S ribosomal protein S14 9606
42 4KZZ 15 O 40S Ribosomal Protein S14 9986
43 4KZX 15 O 40S ribosomal protein S14 9986
44 4KZY 15 O 40S Ribosomal Protein S14 9986
45 7K5I 27 O 40S ribosomal protein S14 9606
46 7A1G 12 Z 40S ribosomal protein S14-B 4932
47 7A09 34 i 40S ribosomal protein S14 9606
48 6ZVH 28 O 40S ribosomal protein S14 9606
49 6ZVI 37 w 40S ribosomal protein S14-B 4932
50 6ZU9 12 Z 40S ribosomal protein S14-A 4932
51 6ZQA 48 DO 40S ribosomal protein S14-A 4932
52 6ZQB 57 DO 40S ribosomal protein S14-A 4932
53 6ZQC 57 DO 40S ribosomal protein S14-A 4932
54 6ZQD 53 DO 40S ribosomal protein S14-A 4932
55 6ZQE 49 DO 40S ribosomal protein S14-A 4932
56 6ZQF 35 DO 40S ribosomal protein S14-A 4932
57 6ZQG 27 DO 40S ribosomal protein S14-A 4932
58 6ZP4 34 i 40S ribosomal protein S14 9606
59 6ZOJ 16 O 40S ribosomal protein S14 9606
60 6ZOK 12 O 40S ribosomal protein S14 9606
61 6ZON 13 i 40S ribosomal protein S14 9606
62 6ZN5 15 P 40S ribosomal protein S14 9606
63 6ZMW 17 P 40S ribosomal protein S14 9606
64 6ZMO 76 SO 40S ribosomal protein S14 9606
65 6ZMT 15 P 40S ribosomal protein S14 9606
66 6ZME 76 SO 40S ribosomal protein S14 9606
67 6ZMI 76 SO 40S ribosomal protein S14 9606
68 6ZLW 15 P 40S ribosomal protein S14 9606
69 6ZM7 76 SO 40S ribosomal protein S14 9606
70 6ZJ3 20 SO Ribosomal protein uS11 3039
71 6XIQ 61 AE 40S ribosomal protein S14-B 4932
72 6XIR 58 AE 40S ribosomal protein S14-B 4932
73 6ZCE 18 P 40S ribosomal protein S14-A 4932
74 6XA1 73 SO 40S ribosomal protein S14 9606
75 6Z6J 20 SO 40S ribosomal protein S14-A 4932
76 6Z6K 20 SO 40S ribosomal protein S14-A 4932
77 6Z6L 74 SO 40S ribosomal protein S14 9606
78 6Z6M 74 SO 40S ribosomal protein S14 9606
79 6Z6N 74 SO 40S ribosomal protein S14 9606
80 6WOO 62 OO uS11 4932
81 6YBW 15 P 40S ribosomal protein S14 9606
82 6YBD 15 P 40S ribosomal protein S14 9606
83 6YAL 17 Q 40S ribosomal protein uS11 9986
84 6YAM 17 Q 40S ribosomal protein uS11 9986
85 6YAN 16 Q 40S ribosomal protein uS11 9986
86 6W2S 13 P uS11 9986
87 6W2T 12 P uS11 9986
88 6Y7C 14 O 40S ribosomal protein S14-A 4932
89 6Y57 63 SO 40S ribosomal protein S14 9606
90 6Y2L 63 SO 40S ribosomal protein S14 9606
91 6Y0G 64 SO 40S ribosomal protein S14 9606
92 6LQP 14 SP 40S ribosomal protein S14-A 4932
93 6LQQ 13 SP 40S ribosomal protein S14-A 4932
94 6LQR 13 SP 40S ribosomal protein S14-A 4932
95 6LQS 13 SP 40S ribosomal protein S14-A 4932
96 6LQT 13 SP 40S ribosomal protein S14-A 4932
97 6LQU 13 SP 40S ribosomal protein S14-A 4932
98 6TNU 18 Z 40S ribosomal protein S14-B 4932
99 6UZ7 62 O 40S ribosomal protein S14 28985
100 6TB3 18 Z 40S ribosomal protein S14-B 4932
101 6T83 17 Ob, p 40S ribosomal protein S14-A 4932
102 6T7T 19 SO 40S ribosomal protein S14-B 4932
103 6T7I 17 SO 40S ribosomal protein S14-A 4932
104 6T4Q 16 SO 40S ribosomal protein S14-B 4932
105 6SV4 33 Z, Zb, Zc 40S ribosomal protein S14-A 4932
106 6SNT 17 O 40S ribosomal protein S14-A 4932
107 6SGC 16 P1 uS11 9986
108 6KE6 14 SP 40S ribosomal protein S14-A 4932
109 6S47 60 BP 40S ribosomal protein S14-A 4932
110 6RXT 39 Ci 40S ribosomal protein S14-like protein 209285
111 6RXU 42 Ci 40S ribosomal protein S14-like protein 209285
112 6RXV 42 Ci 40S ribosomal protein S14-like protein 209285
113 6RXX 24 Ci 40S ribosomal protein S14-like protein 209285
114 6RXY 38 Ci 40S ribosomal protein S14-like protein 209285
115 6RXZ 41 Ci 40S ribosomal protein S14-like protein 209285
116 6P5I 16 P uS11 9986
117 6P5J 16 P uS11 9986
118 6P5K 62 P uS11 9986
119 6P5N 62 P uS11 9986
120 6P4G 16 P uS11 9986
121 6P4H 17 P uS11 9986
122 6OM7 28 SO 40S ribosomal protein S14 9606
123 6OLZ 61 BO 40S ribosomal protein S14 9606
124 6OM0 28 SO 40S ribosomal protein S14 9606
125 6OLE 28 SO 40S ribosomal protein S14 9606
126 6OLF 28 SO 40S ribosomal protein S14 9606
127 6OLG 64 BO 40S ribosomal protein S14 9606
128 6OLI 28 SO 40S ribosomal protein S14 9606
129 6OKK 16 P 40S ribosomal protein S11 5833
130 6RBD 27 O 40S ribosomal protein S14-A 4932
131 6RBE 12 O 40S ribosomal protein S14-A 4932
132 6R7Q 13 MM uS11 9986
133 6R6G 36 MM 40S ribosomal protein S14 9986
134 6R6P 62 MM uS11 9986
135 6R5Q 66 MM uS11 9986
136 6QZP 75 SO 40S ribosomal protein S14 9606
137 6Q8Y 81 Z 40S ribosomal protein S14-B 4932
138 6I7O 33 Z, Zb 40S ribosomal protein S14-B 4932
139 6IP5 74 3L 40S ribosomal protein S14 9606
140 6IP6 73 3L 40S ribosomal protein S14 9606
141 6IP8 73 3L 40S ribosomal protein S14 9606
142 6MTB 65 OO 40S ribosomal protein S14 9986
143 6MTC 64 OO 40S ribosomal protein S14 9986
144 6MTD 66 OO uS11 9986
145 6MTE 65 OO uS11 9986
146 6HCQ 19 P2 uS11 9986
147 6HCJ 19 P2 uS11 9986
148 6HCM 16 P1 uS11 9986
149 6HCF 16 P1 uS11 9986
150 6GZ3 31 BO ribosomal protein uS11 9986
151 6GZ4 34 BO ribosomal protein uS11 9986
152 6GZ5 31 BO ribosomal protein uS11 9986
153 6GSM 18 O 40S ribosomal protein S14 28985
154 6GSN 38 O 40S ribosomal protein S14 28985
155 6GQV 62 AE 40S ribosomal protein S14-B 4932
156 6GQ1 62 AE 40S ribosomal protein S14-B 4932
157 6GQB 62 AE 40S ribosomal protein S14-B 4932
158 6D9J 64 PP uS11 9986
159 6D90 65 PP uS11 9986
160 6G5H 12 O 40S ribosomal protein S14 9606
161 6G5I 16 O 40S ribosomal protein S14 9606
162 6G4S 27 O 40S ribosomal protein S14 9606
163 6G4W 23 O 40S ribosomal protein S14 9606
164 6G51 13 O 40S ribosomal protein S14 9606
165 6G53 13 O 40S ribosomal protein S14 9606
166 6G18 23 O 40S ribosomal protein S14 9606
167 6FYX 18 O 40S ribosomal protein S14 28985
168 6FYY 18 O 40S ribosomal protein S14 28985
169 6FEC 38 j 40S ribosomal protein S14 9606
170 6FAI 25 O 40S ribosomal protein S14-A 4932
171 6EML 22 Z 40S ribosomal protein S14-A 4932
172 6EK0 75 SO 40S ribosomal protein S14 9606
173 6AZ1 15 O ribosomal protein S11 5661
174 5OQL 42 t 40S ribosomal protein S14-like protein 209285
175 5OPT 14 V 40S ribosomal protein S14, putative 5693
176 5WLC 40 NG rpS14_uS11 4932
177 5XXU 16 O Ribosomal protein uS11 5811
178 5OA3 19 O 40S ribosomal protein S14 9606
179 5WYJ 45 SP 40S ribosomal protein S14-A 4932
180 5WYK 41 SP 40S ribosomal protein S14-A 4932
181 5MC6 27 Z 40S ribosomal protein S14-A 4932
182 5M1J 22 O2 40S ribosomal protein S14-A 4932
183 5LZS 65 OO uS11 9986
184 5LZT 66 OO uS11 9986
185 5LZU 65 OO uS11 9986
186 5LZV 66 OO uS11 9986
187 5LZW 66 OO uS11 9986
188 5LZX 66 OO uS11 9986
189 5LZY 64 OO uS11 9986
190 5LZZ 66 OO uS11 9986
191 5T2A 63 AH uS11 5661
192 5T2C 80 AO 40S ribosomal protein S14 9606
193 5LL6 12 Z 40S ribosomal protein S14-A 4932
194 5LKS 74 SO 40S ribosomal protein S14 9606
195 5K0Y 32 j ribosomal protein uS11 9986
196 5JUO 64 LB uS11 (yeast S14) 4932
197 5JUP 64 LB uS11 (yeast S14) 4932
198 5JUS 64 LB uS11 (yeast S14) 4932
199 5JUT 64 LB uS11 (yeast S14) 4932
200 5JUU 64 LB uS11 (yeast S14) 4932
201 5JPQ 29 w uS11 209285
202 5IT7 62 O 40S ribosomal protein S14 28985
203 5IT9 15 O Ribosomal protein uS14 28985
204 5FLX 16 O 40S RIBOSOMAL PROTEIN S14 9986
205 3JAP 18 O uS11 28985
206 3JAQ 18 O uS11 28985
207 3JAM 16 O uS11 28985
208 3JAN 64 SO Ribosomal protein uS11 SEE REMARK 999 9986
209 3JAJ 65 SO Ribosomal protein uS11 SEE REMARK 999 9986
210 3JAG 66 OO uS11 9986
211 3JAH 66 OO uS11 9986
212 3JAI 66 OO uS11 9986
214 4UG0 76 SO 40S RIBOSOMAL PROTEIN S14 9606
215 5AJ0 64 BO 40S ribosomal protein S14 9606
216 4UER 21 K US11 4934
217 4D61 16 O 40S RIBOSOMAL PROTEIN S14 9986
218 4D5L 16 O 40S RIBOSOMAL PROTEIN US11 9986
219 3J81 16 O uS11 28985
220 3J80 12 O uS11 28985
221 3J7P 64 SO Ribosomal protein uS11 9823
222 3J7R 65 SO Ribosomal protein uS11 9823
225 3J7A 16 P 40S ribosomal protein uS11 5833
226 3J77 60 14 40S ribosomal protein S14 4932
227 3J78 60 14 40S ribosomal protein S14 4932
228 3J6X 61 14 40S ribosomal protein S14 4932
229 3J6Y 61 14 40S ribosomal protein S14 4932
231 4V92 17 BO US11 28985
232 4V7E 16 BO 40S ribosomal protein S11 4565
233 4V8Y 23 AO 40S RIBOSOMAL PROTEIN S14-A 4932
234 4V8Z 23 AO 40S RIBOSOMAL PROTEIN S14-A 4932
235 4V6W 5 AO 40S ribosomal protein S14 7227
236 4V6X 5 AO 40S ribosomal protein S14 9606
237 4V8M 16 AH 40S RIBOSOMAL PROTEIN S14 185431
238 3J0O 12 K Ribosomal protein S14 9986
239 3J0L 12 K Ribosomal protein S14 9986
240 4V6I 12 AK 40S ribosomal protein rpS14 (S11p) 4932
241 4V7H 10 AK 40S ribosomal protein S14(A) 5541
242 4V5Z 18 Ak 40S Ribosomal protein S14e 9612
243 4V4B 11 AK 40S ribosomal protein S14-A 4932