6RXV

Cryo-EM structure of the 90S pre-ribosome (Kre33-Noc4) from Chaetomium thermophilum, state B2


Sequence Similarity Clusters for the Entities in PDB 6RXV

Entity #1 | Chains: UA
Periodic tryptophan protein 2-like protein protein, length: 904 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 14249
95 % 3 7 13651
90 % 3 7 13466
70 % 3 7 12689
50 % 17 25 3310
40 % 17 25 3282
30 % 17 25 3247
Entity #10 | Chains: UM
Utp13 protein, length: 912 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 14453
95 % 3 7 14067
90 % 3 7 14274
70 % 3 7 13067
50 % 3 7 11893
40 % 3 7 11157
30 % 3 7 10302
Entity #11 | Chains: UN
Utp14 protein, length: 938 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13650
95 % 3 7 13681
90 % 3 7 13494
70 % 3 7 12487
50 % 3 7 11592
40 % 3 7 10680
30 % 3 7 9873
Entity #12 | Chains: UO
Utp15 protein, length: 557 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 14447
95 % 3 7 13968
90 % 3 7 13857
70 % 3 7 13051
50 % 3 7 12001
40 % 3 7 11144
30 % 16 22 3640
Entity #13 | Chains: UQ
Utp17 protein, length: 960 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13527
95 % 3 7 13413
90 % 3 7 13495
70 % 3 7 12708
50 % 3 7 11383
40 % 3 7 10882
30 % 3 7 9874
Entity #14 | Chains: UR
Utp18 protein, length: 618 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 14114
95 % 3 7 13397
90 % 3 7 13214
70 % 3 7 12467
50 % 3 7 11369
40 % 3 7 10669
30 % 16 24 3364
Entity #15 | Chains: UU
Utp21 protein, length: 1049 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13944
95 % 3 7 14254
90 % 3 7 14040
70 % 3 7 13216
50 % 3 7 12066
40 % 3 7 11300
30 % 3 7 10428
Entity #16 | Chains: UX
Utp24 protein, length: 193 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 8 13071
95 % 3 8 12396
90 % 3 8 12230
70 % 3 8 11626
50 % 17 26 3270
40 % 17 26 3241
30 % 17 26 3216
Entity #17 | Chains: UZ
Utp30 protein, length: 391 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13760
95 % 3 7 14255
90 % 3 7 14041
70 % 3 7 13217
50 % 3 7 12067
40 % 3 7 11301
30 % 3 7 10429
Entity #18 | Chains: CA,CB
Nop1 protein, length: 313 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 5664
95 % 3 7 6291
90 % 3 7 6324
70 % 3 7 6275
50 % 16 24 1632
40 % 16 24 1672
30 % 16 24 1700
Entity #19 | Chains: CC
Nop56 protein, length: 523 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13759
95 % 3 7 13904
90 % 3 7 13727
70 % 3 7 13215
50 % 16 24 3610
40 % 29 41 1984
30 % 29 41 1995
Entity #2 | Chains: UB
Utp2 protein, length: 907 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 14265
95 % 3 7 14287
90 % 3 7 13504
70 % 3 7 12713
50 % 3 7 11602
40 % 3 7 11329
30 % 3 7 10455
Entity #20 | Chains: CD
Nop58 protein, length: 582 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 14659
95 % 3 7 14466
90 % 3 7 14255
70 % 3 7 13413
50 % 3 7 12311
40 % 3 7 11479
30 % 3 7 10572
Entity #21 | Chains: CE,CF
Snu13 protein, length: 127 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 5818
95 % 3 7 6592
90 % 3 7 6631
70 % 3 7 6550
50 % 25 47 947
40 % 26 48 958
30 % 25 47 1028
Entity #22 | Chains: CG
Rrp9 protein, length: 630 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 14487
95 % 3 7 14137
90 % 3 7 13941
70 % 3 7 12988
50 % 3 7 11970
40 % 3 7 11097
30 % 3 7 10240
Entity #23 | Chains: CH
RNA 3'-terminal phosphate cyclase-like protein protein, length: 411 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13693
95 % 3 7 13782
90 % 3 7 13599
70 % 3 7 12808
50 % 3 7 11678
40 % 3 7 10948
30 % 3 7 10109
Entity #24 | Chains: CI
Bms1 protein, length: 1163 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 14411
95 % 3 7 13987
90 % 3 7 13802
70 % 3 7 12989
50 % 3 7 11843
40 % 18 26 3248
30 % 18 26 3222
Entity #25 | Chains: CJ
Imp3 protein, length: 183 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 8 11716
95 % 3 8 11116
90 % 3 8 12803
70 % 3 8 10575
50 % 17 26 3160
40 % 17 26 3140
30 % 17 26 3114
Entity #26 | Chains: CK
Imp4 protein, length: 297 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 8 11028
95 % 3 8 11844
90 % 3 8 11422
70 % 3 8 11163
50 % 18 26 3269
40 % 18 26 3240
30 % 18 26 3215
Entity #27 | Chains: CL
Mpp10 protein, length: 785 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13755
95 % 3 7 14390
90 % 3 7 13721
70 % 3 7 12907
50 % 3 7 11774
40 % 3 7 11032
30 % 3 7 10185
Entity #28 | Chains: CM
Sof1 protein, length: 446 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 14658
95 % 3 7 13758
90 % 3 7 13575
70 % 3 7 12784
50 % 3 7 12244
40 % 15 21 4037
30 % 15 21 3888
Entity #29 | Chains: CN,CO
Emg1 protein, length: 252 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 5776
95 % 3 7 6337
90 % 3 7 6377
70 % 23 32 1242
50 % 23 32 1278
40 % 23 32 1320
30 % 23 32 1360
Entity #3 | Chains: UC
Utp3 protein, length: 648 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 14007
95 % 3 7 14381
90 % 3 7 14165
70 % 3 7 13323
50 % 3 7 12163
40 % 3 7 11406
30 % 18 23 3595
Entity #30 | Chains: CP
KRR1 small subunit processome component protein, length: 322 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 8 9511
95 % 3 8 10341
90 % 3 8 10250
70 % 10 18 4648
50 % 10 18 4436
40 % 10 18 4359
30 % 10 18 4265
Entity #31 | Chains: CQ
Pre-rRNA-processing protein PNO1 protein, length: 259 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13517
95 % 3 7 13358
90 % 3 7 13213
70 % 3 7 12466
50 % 3 7 11341
40 % 3 7 10668
30 % 3 7 9838
Entity #32 | Chains: CR,CS
Kre33 protein, length: 1073 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 8 4427
95 % 3 8 5290
90 % 3 8 5358
70 % 3 8 5340
50 % 11 16 2618
40 % 11 16 2616
30 % 11 16 2606
Entity #33 | Chains: CT
Fcf2 protein, length: 203 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 14231
95 % 3 7 13610
90 % 3 7 13425
70 % 3 7 12652
50 % 3 7 11543
40 % 3 7 10828
30 % 3 7 10000
Entity #34 | Chains: Ca
40S ribosomal protein S1 protein, length: 255 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 5 19332
95 % 3 5 18094
90 % 3 5 17740
70 % 70 110 424
50 % 72 116 440
40 % 101 197 293
30 % 101 197 307
Entity #35 | Chains: Cb
40S ribosomal protein S4 protein, length: 264 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 5 21475
95 % 2 5 19131
90 % 2 5 18710
70 % 100 218 239
50 % 102 228 235
40 % 102 232 236
30 % 109 244 227
Entity #36 | Chains: Cc
40S ribosomal protein s5-like protein protein, length: 212 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 14230
95 % 3 7 13609
90 % 3 7 13424
70 % 33 118 535
50 % 105 239 219
40 % 105 239 225
30 % 105 239 233
Entity #37 | Chains: Cd
40S ribosomal protein S6 protein, length: 239 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 5 19331
95 % 2 5 18093
90 % 2 5 17739
70 % 32 108 578
50 % 101 219 252
40 % 101 224 250
30 % 101 224 258
Entity #38 | Chains: Ce
40S ribosomal protein S7 protein, length: 203 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 14271
95 % 3 7 13697
90 % 3 7 13517
70 % 3 7 12729
50 % 102 226 243
40 % 102 226 245
30 % 104 229 246
Entity #39 | Chains: Cf
40S ribosomal protein S8 protein, length: 202 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 5 21345
95 % 2 5 19347
90 % 2 5 18899
70 % 70 113 413
50 % 102 227 236
40 % 102 231 237
30 % 102 231 244
Entity #4 | Chains: UD
Utp4 protein, length: 884 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 4 8 10385
95 % 4 8 10853
90 % 4 8 10762
70 % 4 8 10357
50 % 4 8 9628
40 % 4 8 9184
30 % 4 8 8568
Entity #40 | Chains: Cg
40S ribosomal protein s9-like protein protein, length: 190 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 14270
95 % 3 7 13696
90 % 3 7 13516
70 % 103 223 234
50 % 105 238 223
40 % 112 249 217
30 % 112 249 223
Entity #41 | Chains: Ch
40S ribosomal protein S13-like protein protein, length: 151 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 14311
95 % 3 7 13770
90 % 3 7 13587
70 % 103 232 227
50 % 105 235 231
40 % 112 247 218
30 % 112 247 224
Entity #42 | Chains: Ci
40S ribosomal protein S14-like protein protein, length: 150 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 14363
95 % 3 7 13873
90 % 33 99 650
70 % 105 236 218
50 % 105 237 226
40 % 105 237 228
30 % 105 237 235
Entity #43 | Chains: Cj
40S ribosomal protein S16-like protein protein, length: 143 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 14272
95 % 3 7 13698
90 % 3 7 13518
70 % 3 7 12730
50 % 103 228 234
40 % 110 239 227
30 % 110 240 230
Entity #44 | Chains: Ck
40S ribosomal protein S11-like protein protein, length: 161 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 5 20197
95 % 2 5 19499
90 % 2 5 19174
70 % 71 115 396
50 % 103 234 232
40 % 103 234 233
30 % 103 234 241
Entity #45 | Chains: Cm
40S ribosomal protein S22-like protein protein, length: 130 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13866
95 % 3 7 14090
90 % 3 7 13897
70 % 103 238 220
50 % 105 240 222
40 % 113 252 213
30 % 552 896 20
Entity #46 | Chains: Cn
40S ribosomal protein s23-like protein protein, length: 145 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 14338
95 % 3 7 13680
90 % 3 7 13492
70 % 105 242 211
50 % 112 255 204
40 % 112 255 210
30 % 112 255 220
Entity #47 | Chains: Co
40S ribosomal protein S24 protein, length: 136 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 5 20269
95 % 2 5 19500
90 % 2 5 19059
70 % 70 115 401
50 % 100 229 238
40 % 100 229 240
30 % 100 229 250
Entity #48 | Chains: Cp
40S ribosomal protein S28-like protein protein, length: 68 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 14364
95 % 3 7 14207
90 % 3 7 13691
70 % 103 229 229
50 % 112 243 214
40 % 112 244 219
30 % 112 244 226
Entity #49 | Chains: CU
Faf1 protein, length: 311 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 14643
95 % 3 7 14447
90 % 3 7 14230
70 % 3 7 13388
50 % 3 7 12218
40 % 3 7 11454
30 % 3 7 10553
Entity #5 | Chains: UF
Utp6 protein, length: 414 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 14142
95 % 3 7 13458
90 % 3 7 13277
70 % 3 7 12525
50 % 3 7 11416
40 % 3 7 10712
30 % 3 7 9904
Entity #50 | Chains: C1
35S ribosomal RNA rna, length: 2352 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
Entity #51 | Chains: C2
U3 snoRNA rna, length: 230 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
Entity #52 | Chains: UV
U3 small nucleolar RNA-associated protein 22 protein, length: 1171 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 4 27179
95 % 1 4 27505
90 % 1 4 26569
70 % 1 4 24132
50 % 1 4 21166
40 % 1 4 19359
30 % 1 4 17345
Entity #53 | Chains: CV
Rrp7 protein, length: 322 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 4 29340
95 % 1 4 23223
90 % 1 4 22609
70 % 1 4 23610
50 % 1 4 20752
40 % 1 4 16849
30 % 1 4 15223
Entity #54 | Chains: CW
Ribosome biogenesis protein ENP2 protein, length: 668 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 4 32214
95 % 2 4 25089
90 % 2 4 24324
70 % 2 4 22143
50 % 2 4 19529
40 % 2 4 17904
30 % 2 4 17163
Entity #55 | Chains: UT
Utp20 protein, length: 2612 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 4 30336
95 % 2 4 24149
90 % 2 4 23883
70 % 2 4 21751
50 % 2 4 18935
40 % 2 4 17614
30 % 2 4 15894
Entity #56 | Chains: UH
Utp8 protein, length: 930 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 6 16982
95 % 3 6 18063
90 % 3 6 17708
70 % 3 6 16302
50 % 3 6 14781
40 % 3 6 13711
30 % 3 6 12495
Entity #57 | Chains: UE,UI
Utp5 protein, length: 410 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 6 7768
95 % 3 6 8365
90 % 3 6 8337
70 % 3 6 8115
50 % 3 6 7455
40 % 3 6 7350
30 % 3 6 6910
Entity #58 | Chains: US
Noc4 protein, length: 549 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 6 18374
95 % 3 6 15811
90 % 3 6 16362
70 % 3 6 15258
50 % 3 6 13230
40 % 3 6 12856
30 % 3 6 11157
Entity #59 | Chains: Cl
Rps18 protein, length: 156 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 6 18112
95 % 3 6 16536
90 % 3 6 16225
70 % 98 215 241
50 % 100 224 239
40 % 107 236 230
30 % 107 237 237
Entity #6 | Chains: UG
Utp7 protein, length: 558 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 14266
95 % 3 7 13689
90 % 3 7 13505
70 % 3 7 12714
50 % 3 7 11603
40 % 15 21 4019
30 % 15 21 3932
Entity #60 | Chains: CX
Enp1 protein, length: 480 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 6 17051
95 % 3 6 14627
90 % 3 6 14417
70 % 3 6 13569
50 % 3 6 12389
40 % 3 6 11610
30 % 18 29 2808
Entity #61 | Chains: CY
U3 small nucleolar ribonucleoprotein protein lcp5-like protein protein, length: 381 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 3 36066
95 % 2 3 28364
90 % 2 3 26741
70 % 2 3 24273
50 % 2 3 21300
40 % 2 3 19472
30 % 2 3 17454
Entity #62 | Chains: CZ
Bfr2 protein, length: 609 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 4 30337
95 % 2 4 25334
90 % 2 4 24559
70 % 2 4 21752
50 % 2 4 19215
40 % 2 4 17615
30 % 2 4 15895
Entity #63 | Chains: UP
Utp16 protein, length: 364 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 6 16728
95 % 3 6 17709
90 % 3 6 15936
70 % 3 6 16113
50 % 3 6 14515
40 % 3 6 13490
30 % 3 6 12304
Entity #7 | Chains: UJ
UTP10 protein, length: 1802 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 8 13427
95 % 3 8 13232
90 % 3 8 12494
70 % 3 8 12327
50 % 3 8 11243
40 % 3 8 10564
30 % 3 8 9768
Entity #8 | Chains: UK
U3 small nucleolar RNA-associated protein 11 protein, length: 270 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 14008
95 % 3 7 14382
90 % 3 7 14166
70 % 3 7 13324
50 % 3 7 12164
40 % 3 7 11407
30 % 3 7 10515
Entity #9 | Chains: UL
Utp12 protein, length: 962 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 14687
95 % 3 7 14503
90 % 3 7 14300
70 % 3 7 13445
50 % 3 7 12278
40 % 17 25 3302
30 % 17 25 3237

Instructions

In the table for each entity, view a list of similar sequences by selecting the link associated with the percentage cutoff.



View more detailed documentation on the redundancy reduction and sequence clustering procedure used by RCSB PDB.

You can also use the structure comparison tool to compare any 2 given structures


ACTION - (A) Select for download / view details OR (B) Select two chains for comparison
Rank PDB ID Entity ID Chains Description Details Taxonomy EC Number
1 4V88 13 AL, CL 40S ribosomal protein S11-A 4932
2 4U4R 13 C1, c1 40S ribosomal protein S11-A 4932
3 4U3U 13 C1, c1 40S ribosomal protein S11-A 4932
4 5TBW 60 M, c1 40S ribosomal protein S11-A 4932
5 4U3M 13 C1, c1 40S ribosomal protein S11-A 4932
6 4U3N 13 C1, c1 40S ribosomal protein S11-A 4932
7 4U52 13 C1, c1 40S ribosomal protein S11-A 4932
8 4U4Q 13 C1, c1 40S ribosomal protein S11-A 4932
9 4U6F 13 C1, c1 40S ribosomal protein S11-A 4932
10 4U4U 13 C1, c1 40S ribosomal protein S11-A 4932
11 4U4Z 13 C1, c1 40S ribosomal protein S11-A 4932
12 4U4Y 13 C1, c1 40S ribosomal protein S11-A 4932
13 4U4N 13 C1, c1 40S ribosomal protein S11-A 4932
14 4U55 13 C1, c1 40S ribosomal protein S11-A 4932
15 5DAT 13 C1, c1 40S ribosomal protein S11-A 4932
16 5I4L 13 C1, c1 40S ribosomal protein S11-A 4932
17 4U51 13 C1, c1 40S ribosomal protein S11-A 4932
18 6HHQ 59 M, c1 40S ribosomal protein S11-A 4932
19 5OBM 57 C1, c1 40S ribosomal protein S11-A 4932
20 4U53 13 C1, c1 40S ribosomal protein S11-A 4932
21 5ON6 61 M, c1 40S ribosomal protein S11-A 4932
22 4U50 13 C1, c1 40S ribosomal protein S11-A 4932
23 5NDV 57 C1, c1 40S ribosomal protein S11-A 4932
24 5LYB 13 C1, c1 40S ribosomal protein S11-A,40S ribosomal protein S11-A,40S Ribosomal Protein S11-A 4932
25 4U56 13 C1, c1 40S ribosomal protein S11-A 4932
26 5TGA 13 C1, c1 40S ribosomal protein S11-A 4932
27 5MEI 60 M, c1 40S ribosomal protein S11-A 4932
28 5FCJ 13 C1, c1 40S ribosomal protein S11-A,40S ribosomal protein S11-A,40S ribosomal protein S11-A,40S ribosomal protein S11-A,40S ribosomal protein S11-A (uS17) (UNK) residues correspond to residues that aren't well resolved, and for which side-chains could not be modeled. (UNK)s were substituted in the original sequence of the crystallized protein. Remaining misalignments result from differences in the distribution of (UNK)s between the two instances of the molecule in the structure. Here is the original sequence ot the crystallized protein : STELTVQSERAFQKQPHIFNNPKVKTSKRTKRWYKNAGLGFKTPKTAIEGSYIDKKCPFTGLVSIRGKILTGTVVSTKMH RTIVIRRAYLHYIPKYNRYEKRHKNVPVHVSPAFRVQVGDIVTVGQCRPISKTVRFNVVKVSAAAAKANKQFAKF 4932
29 4U4O 13 C1, c1 40S ribosomal protein S11-A 4932
30 5DGV 13 C1, c1 40S ribosomal protein S11-A 4932
31 5DGE 13 C1, c1 40S ribosomal protein S11-A 4932
32 5NDW 6 C1, c1 40S ribosomal protein S11-A 4932
33 4BTS 27 AQ, BQ, CQ, DQ 40S RIBOSOMAL PROTEIN RPS11E 5911
34 5NDG 13 C1, c1 40S ribosomal protein S11-A 4932
35 5FCI 13 C1, c1 40S ribosomal protein S11-A,40S ribosomal protein S11-A (uS17) (UNK) residues correspond to residues that aren't well resolved, and for which side-chains could not be modeled. (UNK)s were substituted in the original sequence of the crystallized protein. Remaining misalignments result from differences in the distribution of (UNK)s between the two instances of the molecule in the structure. Here is the original sequence ot the crystallized protein : STELTVQSERAFQKQPHIFNNPKVKTSKRTKRWYKNAGLGFKTPKTAIEGSYIDKKCPFTGLVSIRGKILTGTVVSTKMH RTIVIRRAYLHYIPKYNRYEKRHKNVPVHVSPAFRVQVGDIVTVGQCRPISKTVRFNVVKVSAAAAKANKQFAKF 4932
36 5DC3 13 C1, c1 40S ribosomal protein S11-A 4932
37 5DGF 13 C1, c1 40S ribosomal protein S11-A 4932
38 4V5O 26 AQ, BQ RIBOSOMAL PROTEIN S17 CONTAINING PROTEIN 5911
39 5TGM 13 C1, c1 40S ribosomal protein S11-A,40S Ribosomal Protein S11 4932
40 4V7R 7 AF, CF 40S ribosomal protein S11 4932
41 5VYC 30 L1, L2, L3, L4, L5, L6 40S ribosomal protein S11 9606
42 4KZZ 12 L 40S Ribosomal Protein S11 9986
43 4KZX 12 L 40S ribosomal protein S11 9986
44 4KZY 12 L 40S Ribosomal Protein S11 9986
45 6ZVH 10 L 40S ribosomal protein S11 9606
46 6ZVI 16 t 40S ribosomal protein S11-A 4932
47 6ZQB 55 DL 40S ribosomal protein S11-A 4932
48 6ZQC 55 DL 40S ribosomal protein S11-A 4932
49 6ZQD 51 DL 40S ribosomal protein S11-A 4932
50 6ZQE 47 DL 40S ribosomal protein S11-A 4932
51 6ZQF 33 DL 40S ribosomal protein S11-A 4932
52 6ZQG 25 DL 40S ribosomal protein S11-A 4932
53 6ZP4 11 n 40S ribosomal protein S11 9606
54 6ZOJ 13 L 40S ribosomal protein S11 9606
55 6ZOK 10 L 40S ribosomal protein S11 9606
56 6ZON 11 n 40S ribosomal protein S11 9606
57 6ZN5 11 L 40S ribosomal protein S11 9606
58 6ZMW 25 B 40S ribosomal protein S11 9606
59 6ZMO 58 SL 40S ribosomal protein S11 9606
60 6ZMT 11 L 40S ribosomal protein S11 9606
61 6ZME 58 SL 40S ribosomal protein S11 9606
62 6ZMI 58 SL 40S ribosomal protein S11 9606
63 6ZLW 11 L 40S ribosomal protein S11 9606
64 6ZM7 58 SL 40S ribosomal protein S11 9606
65 6XIQ 27 AB 40S ribosomal protein S11-A 4932
66 6XIR 27 AB 40S ribosomal protein S11-A 4932
67 6Z6J 17 SL 40S ribosomal protein S11-A 4932
68 6Z6K 17 SL 40S ribosomal protein S11-A 4932
69 6Z6L 56 SL 40S ribosomal protein S11 9606
70 6Z6M 56 SL 40S ribosomal protein S11 9606
71 6Z6N 56 SL 40S ribosomal protein S11 9606
72 6WOO 59 LL uS17 4932
73 6YBW 2 B 40S ribosomal protein S11 9606
74 6YAL 14 N 40S ribosomal protein uS17 9986
75 6YAM 14 N 40S ribosomal protein uS17 9986
76 6YAN 13 N Ribosomal protein S11 9986
77 6W2S 11 M uS17 9986
78 6W2T 10 M uS17 9986
79 6Y7C 11 L 40S ribosomal protein S11-A 4932
80 6Y57 61 SL 40S ribosomal protein S11 9606
81 6Y2L 61 SL 40S ribosomal protein S11 9606
82 6Y0G 61 SL 40S ribosomal protein S11 9606
83 6LQP 11 SM 40S ribosomal protein S11-A 4932
84 6LQQ 11 SM 40S ribosomal protein S11-A 4932
85 6LQR 11 SM 40S ribosomal protein S11-A 4932
86 6LQS 11 SM 40S ribosomal protein S11-A 4932
87 6LQT 11 SM 40S ribosomal protein S11-A 4932
88 6LQU 10 SM 40S ribosomal protein S11-A 4932
89 6LQV 9 SM 40S ribosomal protein S11-A 4932
90 6TNU 15 X 40S ribosomal protein S11-A 4932
91 6UZ7 59 L KLLA0A10483p 28985
92 6TB3 15 X 40S ribosomal protein S11-A 4932
93 6T83 14 Lb, m 40S ribosomal protein S11-A 4932
94 6T7T 16 SL 40S ribosomal protein S11-A 4932
95 6T7I 14 SL 40S ribosomal protein S11-A 4932
96 6T4Q 13 SL 40S ribosomal protein S11-A 4932
97 6SV4 30 X, Xb, Xc 40S ribosomal protein S11-A 4932
98 6SNT 14 L 40S ribosomal protein S11-A 4932
99 6SGC 13 M1 Ribosomal protein S11 9986
100 6KE6 11 SM 40S ribosomal protein S11-A 4932
101 6S47 57 BM 40S ribosomal protein S11-A 4932
102 6RXU 44 Ck 40S ribosomal protein S11-like protein 209285
103 6RXV 44 Ck 40S ribosomal protein S11-like protein 209285
104 6RXX 41 Ck 40S ribosomal protein S11-like protein 209285
105 6RXZ 43 Ck 40S ribosomal protein S11-like protein 209285
106 6P5I 13 M uS17 9986
107 6P5J 13 M uS17 9986
108 6P5K 59 M uS17 9986
109 6P5N 59 M uS17 9986
110 6P4G 13 M uS17 9986
111 6P4H 14 M uS17 9986
112 6OM7 10 SL 40S ribosomal protein S11 9606
113 6OLZ 58 BL 40S ribosomal protein S11 9606
114 6OM0 10 SL 40S ribosomal protein S11 9606
115 6OLE 10 SL 40S ribosomal protein S11 9606
116 6OLF 10 SL 40S ribosomal protein S11 9606
117 6OLG 61 BL 40S ribosomal protein S11 9606
118 6OLI 10 SL 40S ribosomal protein S11 9606
119 6OKK 22 V 40S ribosomal protein S11 5833
120 6RBD 12 L 40S ribosomal protein S11-A 4932
121 6RBE 10 L 40S ribosomal protein S11-A 4932
122 6R7Q 5 EE Ribosomal protein S11 9986
123 6R6G 19 EE Ribosomal protein S11 9986
124 6R6P 60 EE Ribosomal protein S11 9986
125 6R5Q 63 EE Ribosomal protein S11 9986
126 6QZP 57 SL 40S ribosomal protein S11 9606
127 6Q8Y 79 X 40S ribosomal protein S11-A 4932
128 6I7O 30 X, Xb 40S ribosomal protein S11-A 4932
129 6IP5 56 2v 40S ribosomal protein S11 9606
130 6IP6 55 2v 40S ribosomal protein S11 9606
131 6IP8 55 2v 40S ribosomal protein S11 9606
132 6MTB 62 LL 40S ribosomal protein S11 9986
133 6MTC 61 LL 40S ribosomal protein S11 9986
134 6MTD 63 LL uS17 9986
135 6MTE 62 LL uS17 9986
136 6HCQ 16 M2 Ribosomal protein S11 9986
137 6HCJ 16 M2 Ribosomal protein S11 9986
138 6HCM 13 M1 Ribosomal protein S11 9986
139 6HCF 13 M1 Ribosomal protein S11 9986
140 6GZ3 29 BL Ribosomal protein S11 9986
141 6GZ4 32 BL ribosomal protein uS17 9986
142 6GZ5 29 BL ribosomal protein uS17 9986
143 6GSM 15 L KLLA0A10483p 28985
144 6GSN 36 L KLLA0A10483p 28985
145 6GQV 59 AB 40S ribosomal protein S11-A 4932
146 6GQ1 59 AB 40S ribosomal protein S11-A 4932
147 6GQB 59 AB 40S ribosomal protein S11-A 4932
148 6D9J 61 MM uS17 9986
149 6D90 62 MM uS17 9986
150 6G5H 10 L 40S ribosomal protein S11 9606
151 6G5I 13 L 40S ribosomal protein S11 9606
152 6G4S 29 L 40S ribosomal protein S11 9606
153 6G4W 25 L 40S ribosomal protein S11 9606
154 6G51 11 L 40S ribosomal protein S11 9606
155 6G53 11 L 40S ribosomal protein S11 9606
156 6G18 21 L 40S ribosomal protein S11 9606
157 6FYX 15 L KLLA0A10483p 28985
158 6FYY 15 L KLLA0A10483p 28985
159 6FEC 12 G 40S ribosomal protein S11 9606
160 6FAI 22 L 40S ribosomal protein S11-A 4932
161 6EML 20 X 40S ribosomal protein S11-A 4932
162 6EK0 57 SL 40S ribosomal protein S11 9606
163 6AZ1 21 U ribosomal protein S17 5661
164 5OQL 44 v 40S ribosomal protein S11-like protein 209285
165 5OPT 16 X 40S ribosomal protein S11, putative 5693
166 5WLC 12 LD rpS11_uS17 4932
167 5XYI 13 L Uncharacterized protein 5722
168 5XXU 13 L Ribosomal protein uS17 5811
169 5OA3 16 L 40S ribosomal protein S11 9606
170 5WYJ 42 SM 40S ribosomal protein S11-A 4932
171 5WYK 39 SM 40S ribosomal protein S11-A 4932
172 5TZS 13 D rpS11_uS17 4932
173 5MC6 25 X 40S ribosomal protein S11-A 4932
174 5M1J 19 L2 40S ribosomal protein S11-A 4932
175 5LZS 62 LL uS17 9986
176 5LZT 63 LL uS17 9986
177 5LZU 62 LL uS17 9986
178 5LZV 63 LL uS17 9986
179 5LZW 63 LL uS17 9986
180 5LZX 63 LL uS17 9986
181 5LZY 61 LL uS17 9986
182 5LZZ 63 LL uS17 9986
183 5T2A 61 AE uS17 5661
184 5T2C 73 Aw 40S ribosomal protein S11 9606
185 5LL6 10 X 40S ribosomal protein S11-A 4932
186 5LKS 56 SL 40S ribosomal protein S11 9606
187 5K0Y 5 G ribosomal protein uS17 9986
188 5JUO 61 IB uS17 (yeast S11) 4932
189 5JUP 61 IB uS17 (yeast S11) 4932
190 5JUS 61 IB uS17 (yeast S11) 4932
191 5JUT 61 IB uS17 (yeast S11) 4932
192 5JUU 61 IB uS17 (yeast S11) 4932
193 5JPQ 31 y uS17 209285
194 5IT7 59 L KLLA0A10483p 28985
195 5IT9 12 L Ribosomal protein uS17 28985
196 5FLX 13 L 40S RIBOSOMAL PROTEIN S11 9986
197 3JBN 31 V 40S ribosomal protein uS17 5833
198 3JBO 8 V 40S ribosomal protein uS17 5833
199 3JBP 31 V 40S ribosomal protein uS17 5833
200 3JAP 15 L uS17 28985
201 3JAQ 15 L uS17 28985
202 3JAM 13 L uS17 28985
203 3JAN 62 SL Ribosomal protein uS17 SEE REMARK 999 9986
204 3JAJ 63 SL Ribosomal protein uS17 SEE REMARK 999 9986
205 3JAG 63 LL uS17 9986
206 3JAH 63 LL uS17 9986
207 3JAI 63 LL uS17 9986
208 5A2Q 14 L RIBOSOMAL PROTEIN US17 9606
209 4UG0 57 SL 40S RIBOSOMAL PROTEIN S11 9606
210 5AJ0 61 BL 40S ribosomal protein S11 9606
211 4UER 27 Q US17 4934
212 4D61 13 L 40S RIBOSOMAL PROTEIN S11 9986
213 4D5L 13 L 40S RIBOSOMAL PROTEIN US17 9986
214 3J81 13 L uS17 28985
215 3J80 10 L uS17 28985
216 3J7P 61 SL Ribosomal protein uS17 9823
217 3J7R 62 SL Ribosomal protein uS17 9823
218 4UJC 62 CL 40S RIBOSOMAL PROTEIN US17 9986
219 4UJD 62 CL 40S RIBOSOMAL PROTEIN US17 9986
220 3J7A 22 V 40S ribosomal protein uS17 5833
221 3J77 57 11 40S ribosomal protein S11 4932
222 3J78 57 11 40S ribosomal protein S11 4932
223 3J6X 58 11 40S ribosomal protein S11 4932
224 3J6Y 58 11 40S ribosomal protein S11 4932
225 4UJE 16 BL 40S RIBOSOMAL PROTEIN S11 9986
226 4V92 14 BL US17 28985
227 4V7E 19 BL 40S ribosomal protein S17 4565
228 4V8Y 20 AL 40S RIBOSOMAL PROTEIN S11-A 4932
229 4V8Z 20 AL 40S RIBOSOMAL PROTEIN S11-A 4932
230 4V6W 11 AL 40S ribosomal protein S11 7227
231 4V6X 11 AL 40S ribosomal protein S11 9606
232 4V8M 13 AE 40S RIBOSOMAL PROTEINS S11, PUTATIVE 185431
233 4V6I 18 AP 40S ribosomal protein rpS11 (S17p) 4932
234 4V5Z 23 Aq 40S Ribosomal protein S11e 9612