6RXV

Cryo-EM structure of the 90S pre-ribosome (Kre33-Noc4) from Chaetomium thermophilum, state B2


Sequence Similarity Clusters for the Entities in PDB 6RXV

Entity #1 | Chains: UA
Periodic tryptophan protein 2-like protein protein, length: 904 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 12829
95 % 3 7 12829
90 % 3 7 12632
70 % 3 7 12032
50 % 3 11 7263
40 % 3 11 6999
30 % 3 11 6561
Entity #10 | Chains: UM
Utp13 protein, length: 912 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13600
95 % 3 7 13259
90 % 3 7 13450
70 % 3 7 12762
50 % 3 7 11326
40 % 3 7 10649
30 % 3 7 9828
Entity #11 | Chains: UN
Utp14 protein, length: 938 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13260
95 % 3 7 12649
90 % 3 7 12454
70 % 3 7 12816
50 % 3 7 10978
40 % 3 7 10176
30 % 3 7 9421
Entity #12 | Chains: UO
Utp15 protein, length: 557 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13599
95 % 3 7 13258
90 % 3 7 13075
70 % 3 7 12423
50 % 3 7 11332
40 % 3 7 10648
30 % 3 9 7857
Entity #13 | Chains: UQ
Utp17 protein, length: 960 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 12972
95 % 3 7 13130
90 % 3 7 12935
70 % 3 7 12298
50 % 3 7 11230
40 % 3 7 10535
30 % 3 7 9735
Entity #14 | Chains: UR
Utp18 protein, length: 618 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 12973
95 % 3 7 13131
90 % 3 7 12936
70 % 3 7 12299
50 % 3 7 11231
40 % 3 7 10536
30 % 3 11 6606
Entity #15 | Chains: UU
Utp21 protein, length: 1049 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13601
95 % 3 7 13260
90 % 3 7 13076
70 % 3 7 12424
50 % 3 7 11333
40 % 3 7 10650
30 % 3 7 9829
Entity #16 | Chains: UX
Utp24 protein, length: 193 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 8 12299
95 % 3 8 11688
90 % 3 8 11541
70 % 3 8 11036
50 % 3 12 6691
40 % 3 12 6472
30 % 3 12 6134
Entity #17 | Chains: UZ
Utp30 protein, length: 391 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 12974
95 % 3 7 13514
90 % 3 7 13502
70 % 3 7 12300
50 % 3 7 11525
40 % 3 7 10991
30 % 3 7 9736
Entity #18 | Chains: CA,CB
Nop1 protein, length: 313 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 5396
95 % 3 7 6136
90 % 3 7 6171
70 % 3 7 6090
50 % 3 11 3524
40 % 3 11 3508
30 % 3 11 3431
Entity #19 | Chains: CC
Nop56 protein, length: 523 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13363
95 % 3 7 12799
90 % 3 7 12603
70 % 3 7 12010
50 % 3 11 7305
40 % 3 15 5222
30 % 3 15 5007
Entity #2 | Chains: UB
Utp2 protein, length: 907 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13593
95 % 3 7 13248
90 % 3 7 13065
70 % 3 7 12413
50 % 3 7 11323
40 % 3 7 10640
30 % 3 7 9818
Entity #20 | Chains: CD
Nop58 protein, length: 582 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13652
95 % 3 7 13346
90 % 3 7 13159
70 % 3 7 12507
50 % 3 7 11408
40 % 3 7 10720
30 % 3 7 9891
Entity #21 | Chains: CE,CF
Snu13 protein, length: 127 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 5188
95 % 3 7 6259
90 % 3 7 6281
70 % 3 7 6190
50 % 12 34 1375
40 % 13 35 1367
30 % 12 34 1463
Entity #22 | Chains: CG
Rrp9 protein, length: 630 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13108
95 % 3 7 13394
90 % 3 7 13205
70 % 3 7 12539
50 % 3 7 11443
40 % 3 7 10754
30 % 3 7 9921
Entity #23 | Chains: CH
RNA 3'-terminal phosphate cyclase-like protein protein, length: 411 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13796
95 % 3 7 13640
90 % 3 7 13012
70 % 3 7 12754
50 % 3 7 11276
40 % 3 7 10940
30 % 3 7 10095
Entity #24 | Chains: CI
Bms1 protein, length: 1163 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13109
95 % 3 7 12888
90 % 3 7 13206
70 % 3 7 12540
50 % 3 7 11444
40 % 3 11 7264
30 % 3 11 6820
Entity #25 | Chains: CJ
Imp3 protein, length: 183 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 8 10300
95 % 3 8 11160
90 % 3 8 11027
70 % 3 8 10566
50 % 3 12 6666
40 % 3 12 6445
30 % 3 12 6104
Entity #26 | Chains: CK
Imp4 protein, length: 297 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 8 12597
95 % 3 8 12428
90 % 3 8 12239
70 % 3 8 11669
50 % 3 11 7365
40 % 3 11 7098
30 % 3 11 6663
Entity #27 | Chains: CL
Mpp10 protein, length: 785 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 12922
95 % 3 7 13024
90 % 3 7 12831
70 % 3 7 12218
50 % 3 7 11142
40 % 3 7 10450
30 % 3 7 9667
Entity #28 | Chains: CM
Sof1 protein, length: 446 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13175
95 % 3 7 13561
90 % 3 7 12498
70 % 3 7 11922
50 % 3 7 11583
40 % 3 9 8676
30 % 3 9 7613
Entity #29 | Chains: CN,CO
Emg1 protein, length: 252 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 5155
95 % 3 7 6187
90 % 3 7 6217
70 % 8 17 2385
50 % 8 17 2409
40 % 8 17 2430
30 % 8 17 2421
Entity #3 | Chains: UC
Utp3 protein, length: 648 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13310
95 % 3 7 12699
90 % 3 7 12509
70 % 3 7 11931
50 % 3 7 10879
40 % 3 7 10216
30 % 3 7 9462
Entity #30 | Chains: CP
KRR1 small subunit processome component protein, length: 322 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 8 9436
95 % 3 8 9627
90 % 3 8 9601
70 % 3 11 6932
50 % 3 11 6592
40 % 3 11 6312
30 % 3 11 6005
Entity #31 | Chains: CQ
Pre-rRNA-processing protein PNO1 protein, length: 259 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13388
95 % 3 7 12849
90 % 3 7 12754
70 % 3 7 12053
50 % 3 7 10987
40 % 3 7 10316
30 % 3 7 9551
Entity #32 | Chains: CR,CS
Kre33 protein, length: 1073 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 8 4618
95 % 3 8 5389
90 % 3 8 5164
70 % 3 8 5123
50 % 3 8 4975
40 % 3 8 5054
30 % 3 8 4682
Entity #33 | Chains: CT
Fcf2 protein, length: 203 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 12721
95 % 3 7 12611
90 % 3 7 12423
70 % 3 7 11951
50 % 3 7 10832
40 % 3 7 10175
30 % 3 7 9420
Entity #34 | Chains: Ca
40S ribosomal protein S1 protein, length: 255 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 5 18785
95 % 3 5 18031
90 % 3 5 18475
70 % 49 89 460
50 % 54 145 352
40 % 56 152 351
30 % 56 152 363
Entity #35 | Chains: Cb
40S ribosomal protein S4 protein, length: 264 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 5 18204
95 % 2 5 17155
90 % 2 5 16858
70 % 53 171 265
50 % 55 181 258
40 % 55 185 262
30 % 59 194 258
Entity #36 | Chains: Cc
40S ribosomal protein s5-like protein protein, length: 212 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13432
95 % 3 7 13550
90 % 3 7 12759
70 % 8 93 654
50 % 57 191 233
40 % 57 191 245
30 % 57 191 261
Entity #37 | Chains: Cd
40S ribosomal protein S6 protein, length: 239 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 5 20314
95 % 2 5 18560
90 % 2 5 18208
70 % 7 83 737
50 % 54 172 299
40 % 54 177 300
30 % 54 177 324
Entity #38 | Chains: Ce
40S ribosomal protein S7 protein, length: 203 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13791
95 % 3 7 13627
90 % 3 7 13429
70 % 3 7 12746
50 % 54 178 275
40 % 54 178 291
30 % 56 181 294
Entity #39 | Chains: Cf
40S ribosomal protein S8 protein, length: 202 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 5 19789
95 % 2 5 17496
90 % 2 5 17378
70 % 48 91 444
50 % 55 180 260
40 % 55 184 266
30 % 55 184 283
Entity #4 | Chains: UD
Utp4 protein, length: 884 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 4 8 9730
95 % 4 8 10222
90 % 4 8 10126
70 % 4 8 9810
50 % 4 8 9142
40 % 4 8 8730
30 % 4 8 8144
Entity #40 | Chains: Cg
40S ribosomal protein s9-like protein protein, length: 190 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 12879
95 % 3 7 12932
90 % 3 7 12743
70 % 55 175 251
50 % 57 190 235
40 % 61 198 233
30 % 61 198 249
Entity #41 | Chains: Ch
40S ribosomal protein S13-like protein protein, length: 151 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13511
95 % 3 7 13107
90 % 3 7 12907
70 % 55 180 246
50 % 57 187 241
40 % 61 195 238
30 % 61 196 254
Entity #42 | Chains: Ci
40S ribosomal protein S14-like protein protein, length: 150 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13051
95 % 3 7 13429
90 % 7 73 814
70 % 57 188 220
50 % 57 189 237
40 % 57 189 253
30 % 57 189 269
Entity #43 | Chains: Cj
40S ribosomal protein S16-like protein protein, length: 143 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13433
95 % 3 7 12948
90 % 3 7 13132
70 % 3 7 12148
50 % 57 182 251
40 % 61 190 247
30 % 61 191 262
Entity #44 | Chains: Ck
40S ribosomal protein S11-like protein protein, length: 161 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 5 19009
95 % 2 5 18403
90 % 2 5 18605
70 % 49 93 435
50 % 56 187 240
40 % 56 187 255
30 % 56 187 271
Entity #45 | Chains: Cm
40S ribosomal protein S22-like protein protein, length: 130 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13512
95 % 3 7 13108
90 % 3 7 12908
70 % 56 191 224
50 % 58 193 230
40 % 58 194 242
30 % 425 763 21
Entity #46 | Chains: Cn
40S ribosomal protein s23-like protein protein, length: 145 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13674
95 % 3 7 13637
90 % 3 7 12735
70 % 57 194 196
50 % 61 204 211
40 % 61 204 228
30 % 61 204 244
Entity #47 | Chains: Co
40S ribosomal protein S24 protein, length: 136 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 5 18968
95 % 2 5 18317
90 % 2 5 17974
70 % 2 5 16745
50 % 53 182 267
40 % 53 182 279
30 % 53 182 303
Entity #48 | Chains: Cp
40S ribosomal protein S28-like protein protein, length: 68 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 12877
95 % 3 7 12924
90 % 3 7 12736
70 % 55 181 240
50 % 61 192 231
40 % 61 193 241
30 % 61 193 257
Entity #49 | Chains: CU
Faf1 protein, length: 311 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13369
95 % 3 7 12812
90 % 3 7 12613
70 % 3 7 12021
50 % 3 7 10964
40 % 3 7 10298
30 % 3 7 9532
Entity #5 | Chains: UF
Utp6 protein, length: 414 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13805
95 % 3 7 13668
90 % 3 7 13444
70 % 3 7 12782
50 % 3 7 11683
40 % 3 7 10968
30 % 3 7 10126
Entity #50 | Chains: C1
35S ribosomal RNA rna, length: 2352 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
Entity #51 | Chains: C2
U3 snoRNA rna, length: 230 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
Entity #52 | Chains: UV
U3 small nucleolar RNA-associated protein 22 protein, length: 1171 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 4 30463
95 % 1 4 25630
90 % 1 4 24801
70 % 1 4 22615
50 % 1 4 19923
40 % 1 4 18236
30 % 1 4 16376
Entity #53 | Chains: CV
Rrp7 protein, length: 322 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 4 24023
95 % 1 4 23891
90 % 1 4 23141
70 % 1 4 21181
50 % 1 4 18714
40 % 1 4 17186
30 % 1 4 15470
Entity #54 | Chains: CW
Ribosome biogenesis protein ENP2 protein, length: 668 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 4 27155
95 % 2 4 21044
90 % 2 4 20492
70 % 2 4 20815
50 % 2 4 18406
40 % 2 4 16902
30 % 2 4 15223
Entity #55 | Chains: UT
Utp20 protein, length: 2612 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 4 24024
95 % 2 4 23892
90 % 2 4 23142
70 % 2 4 22823
50 % 2 4 20087
40 % 2 4 18382
30 % 2 4 16500
Entity #56 | Chains: UH
Utp8 protein, length: 930 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 6 17265
95 % 3 6 14597
90 % 3 6 14664
70 % 3 6 13620
50 % 3 6 13160
40 % 3 6 12256
30 % 3 6 10822
Entity #57 | Chains: UE,UI
Utp5 protein, length: 410 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 6 6571
95 % 3 6 7872
90 % 3 6 7830
70 % 3 6 7640
50 % 3 6 7179
40 % 3 6 6922
30 % 3 6 6498
Entity #58 | Chains: US
Noc4 protein, length: 549 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 6 17144
95 % 3 6 15108
90 % 3 6 14869
70 % 3 6 14388
50 % 3 6 13158
40 % 3 6 12150
30 % 3 6 11139
Entity #59 | Chains: Cl
Rps18 protein, length: 156 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 6 17596
95 % 3 6 16213
90 % 3 6 15923
70 % 55 173 257
50 % 57 182 253
40 % 61 192 243
30 % 61 192 260
Entity #6 | Chains: UG
Utp7 protein, length: 558 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 12830
95 % 3 7 12830
90 % 3 7 12633
70 % 3 7 11860
50 % 3 7 10819
40 % 3 9 8728
30 % 3 9 7614
Entity #60 | Chains: CX
Enp1 protein, length: 480 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 6 18102
95 % 3 6 16931
90 % 3 6 16649
70 % 3 6 15571
50 % 3 6 14057
40 % 3 6 13061
30 % 4 15 5049
Entity #61 | Chains: CY
U3 small nucleolar ribonucleoprotein protein lcp5-like protein protein, length: 381 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 3 34328
95 % 2 3 27100
90 % 2 3 25564
70 % 2 3 23288
50 % 2 3 20905
40 % 2 3 19135
30 % 2 3 16783
Entity #62 | Chains: CZ
Bfr2 protein, length: 609 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 4 25975
95 % 2 4 19320
90 % 2 4 18906
70 % 2 4 17559
50 % 2 4 15773
40 % 2 4 14644
30 % 2 4 13299
Entity #63 | Chains: UP
Utp16 protein, length: 364 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 6 16654
95 % 3 6 15575
90 % 3 6 15308
70 % 3 6 14443
50 % 3 6 13068
40 % 3 6 12182
30 % 3 6 11168
Entity #7 | Chains: UJ
UTP10 protein, length: 1802 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 8 11037
95 % 3 8 12273
90 % 3 8 12109
70 % 3 8 11542
50 % 3 8 10556
40 % 3 8 9946
30 % 3 8 9212
Entity #8 | Chains: UK
U3 small nucleolar RNA-associated protein 11 protein, length: 270 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13427
95 % 3 7 12933
90 % 3 7 12745
70 % 3 7 12131
50 % 3 7 11063
40 % 3 7 10393
30 % 3 7 9616
Entity #9 | Chains: UL
Utp12 protein, length: 962 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13708
95 % 3 7 13481
90 % 3 7 13288
70 % 3 7 12610
50 % 3 7 11513
40 % 3 11 7061
30 % 3 11 6625

Instructions

In the table for each entity, view a list of similar sequences by selecting the link associated with the percentage cutoff.



View more detailed documentation on the redundancy reduction and sequence clustering procedure used by RCSB PDB.

You can also use the structure comparison tool to compare any 2 given structures


ACTION - (A) Select for download / view details OR (B) Select two chains for comparison
Rank PDB ID Entity ID Chains Description Details Taxonomy EC Number
1 4V88 13 AL, CL 40S ribosomal protein S11-A 4932
2 4U4R 13 C1, c1 40S ribosomal protein S11-A 4932
3 4U3U 13 C1, c1 40S ribosomal protein S11-A 4932
4 5TBW 60 M, c1 40S ribosomal protein S11-A 4932
5 4U3M 13 C1, c1 40S ribosomal protein S11-A 4932
6 4U3N 13 C1, c1 40S ribosomal protein S11-A 4932
7 4U52 13 C1, c1 40S ribosomal protein S11-A 4932
8 4U4Q 13 C1, c1 40S ribosomal protein S11-A 4932
9 4U6F 13 C1, c1 40S ribosomal protein S11-A 4932
10 4U4U 13 C1, c1 40S ribosomal protein S11-A 4932
11 4U4Z 13 C1, c1 40S ribosomal protein S11-A 4932
12 4U4Y 13 C1, c1 40S ribosomal protein S11-A 4932
13 4U4N 13 C1, c1 40S ribosomal protein S11-A 4932
14 4U55 13 C1, c1 40S ribosomal protein S11-A 4932
15 5DAT 13 C1, c1 40S ribosomal protein S11-A 4932
16 5I4L 13 C1, c1 40S ribosomal protein S11-A 4932
17 4U51 13 C1, c1 40S ribosomal protein S11-A 4932
18 6HHQ 59 M, c1 40S ribosomal protein S11-A 4932
19 5OBM 57 C1, c1 40S ribosomal protein S11-A 4932
20 4U53 13 C1, c1 40S ribosomal protein S11-A 4932
21 5ON6 61 M, c1 40S ribosomal protein S11-A 4932
22 4U50 13 C1, c1 40S ribosomal protein S11-A 4932
23 5NDV 57 C1, c1 40S ribosomal protein S11-A 4932
24 5LYB 13 C1, c1 40S ribosomal protein S11-A,40S ribosomal protein S11-A,40S Ribosomal Protein S11-A 4932
25 4U56 13 C1, c1 40S ribosomal protein S11-A 4932
26 5TGA 13 C1, c1 40S ribosomal protein S11-A 4932
27 5MEI 60 M, c1 40S ribosomal protein S11-A 4932
28 5FCJ 13 C1, c1 40S ribosomal protein S11-A,40S ribosomal protein S11-A,40S ribosomal protein S11-A,40S ribosomal protein S11-A,40S ribosomal protein S11-A (uS17) (UNK) residues correspond to residues that aren't well resolved, and for which side-chains could not be modeled. (UNK)s were substituted in the original sequence of the crystallized protein. Remaining misalignments result from differences in the distribution of (UNK)s between the two instances of the molecule in the structure. Here is the original sequence ot the crystallized protein : STELTVQSERAFQKQPHIFNNPKVKTSKRTKRWYKNAGLGFKTPKTAIEGSYIDKKCPFTGLVSIRGKILTGTVVSTKMH RTIVIRRAYLHYIPKYNRYEKRHKNVPVHVSPAFRVQVGDIVTVGQCRPISKTVRFNVVKVSAAAAKANKQFAKF 4932
29 4U4O 13 C1, c1 40S ribosomal protein S11-A 4932
30 5DGV 13 C1, c1 40S ribosomal protein S11-A 4932
31 5DGE 13 C1, c1 40S ribosomal protein S11-A 4932
32 5NDW 6 C1, c1 40S ribosomal protein S11-A 4932
33 4BTS 27 AQ, BQ, CQ, DQ 40S RIBOSOMAL PROTEIN RPS11E 5911
34 5NDG 13 C1, c1 40S ribosomal protein S11-A 4932
35 5FCI 13 C1, c1 40S ribosomal protein S11-A,40S ribosomal protein S11-A (uS17) (UNK) residues correspond to residues that aren't well resolved, and for which side-chains could not be modeled. (UNK)s were substituted in the original sequence of the crystallized protein. Remaining misalignments result from differences in the distribution of (UNK)s between the two instances of the molecule in the structure. Here is the original sequence ot the crystallized protein : STELTVQSERAFQKQPHIFNNPKVKTSKRTKRWYKNAGLGFKTPKTAIEGSYIDKKCPFTGLVSIRGKILTGTVVSTKMH RTIVIRRAYLHYIPKYNRYEKRHKNVPVHVSPAFRVQVGDIVTVGQCRPISKTVRFNVVKVSAAAAKANKQFAKF 4932
36 5DC3 13 C1, c1 40S ribosomal protein S11-A 4932
37 5DGF 13 C1, c1 40S ribosomal protein S11-A 4932
38 4V5O 26 AQ, BQ RIBOSOMAL PROTEIN S17 CONTAINING PROTEIN 5911
39 5TGM 13 C1, c1 40S ribosomal protein S11-A,40S Ribosomal Protein S11 4932
40 4V7R 7 AF, CF 40S ribosomal protein S11 4932
41 5VYC 30 L1, L2, L3, L4, L5, L6 40S ribosomal protein S11 9606
42 4KZZ 12 L 40S Ribosomal Protein S11 9986
43 4KZX 12 L 40S ribosomal protein S11 9986
44 4KZY 12 L 40S Ribosomal Protein S11 9986
45 6Y7C 11 L 40S ribosomal protein S11-A 4932
46 6UZ7 59 L KLLA0A10483p 28985
47 6T83 14 Lb, m 40S ribosomal protein S11-A 4932
48 6T7T 16 SL 40S ribosomal protein S11-A 4932
49 6T7I 14 SL 40S ribosomal protein S11-A 4932
50 6T4Q 13 SL 40S ribosomal protein S11-A 4932
51 6SV4 30 X, Xb, Xc 40S ribosomal protein S11-A 4932
52 6SNT 14 L 40S ribosomal protein S11-A 4932
53 6SGC 13 M1 Ribosomal protein S11 9986
54 6S47 57 BM 40S ribosomal protein S11-A 4932
55 6RXU 44 Ck 40S ribosomal protein S11-like protein 209285
56 6RXV 44 Ck 40S ribosomal protein S11-like protein 209285
57 6RXX 41 Ck 40S ribosomal protein S11-like protein 209285
58 6RXZ 43 Ck 40S ribosomal protein S11-like protein 209285
59 6P5I 13 M uS17 9986
60 6P5J 13 M uS17 9986
61 6P5K 59 M uS17 9986
62 6P5N 59 M uS17 9986
63 6P4G 13 M uS17 9986
64 6P4H 14 M uS17 9986
65 6OM7 10 SL 40S ribosomal protein S11 9606
66 6OLZ 58 BL 40S ribosomal protein S11 9606
67 6OM0 10 SL 40S ribosomal protein S11 9606
68 6OLE 10 SL 40S ribosomal protein S11 9606
69 6OLF 10 SL 40S ribosomal protein S11 9606
70 6OLG 61 BL 40S ribosomal protein S11 9606
71 6OLI 10 SL 40S ribosomal protein S11 9606
72 6OKK 22 V 40S ribosomal protein S11 5833
73 6RBD 12 L 40S ribosomal protein S11-A 4932
74 6RBE 10 L 40S ribosomal protein S11-A 4932
75 6R7Q 5 EE Ribosomal protein S11 9986
76 6R6G 19 EE Ribosomal protein S11 9986
77 6R6P 60 EE Ribosomal protein S11 9986
78 6R5Q 63 EE Ribosomal protein S11 9986
79 6QZP 57 SL 40S ribosomal protein S11 9606
80 6Q8Y 79 X 40S ribosomal protein S11-A 4932
81 6I7O 30 X, Xb 40S ribosomal protein S11-A 4932
82 6IP5 56 2v 40S ribosomal protein S11 9606
83 6IP6 55 2v 40S ribosomal protein S11 9606
84 6IP8 55 2v 40S ribosomal protein S11 9606
85 6MTB 62 LL 40S ribosomal protein S11 9986
86 6MTC 61 LL 40S ribosomal protein S11 9986
87 6MTD 63 LL uS17 9986
88 6MTE 62 LL uS17 9986
89 6HCQ 16 M2 Ribosomal protein S11 9986
90 6HCJ 16 M2 Ribosomal protein S11 9986
91 6HCM 13 M1 Ribosomal protein S11 9986
92 6HCF 13 M1 Ribosomal protein S11 9986
93 6GZ3 29 BL Ribosomal protein S11 9986
94 6GZ4 32 BL ribosomal protein uS17 9986
95 6GZ5 29 BL ribosomal protein uS17 9986
96 6GSM 15 L KLLA0A10483p 28985
97 6GSN 36 L KLLA0A10483p 28985
98 6GQV 59 AB 40S ribosomal protein S11-A 4932
99 6GQ1 59 AB 40S ribosomal protein S11-A 4932
100 6GQB 59 AB 40S ribosomal protein S11-A 4932
101 6D9J 61 MM uS17 9986
102 6D90 62 MM uS17 9986
103 6G5H 10 L 40S ribosomal protein S11 9606
104 6G5I 13 L 40S ribosomal protein S11 9606
105 6G4S 29 L 40S ribosomal protein S11 9606
106 6G4W 25 L 40S ribosomal protein S11 9606
107 6G51 11 L 40S ribosomal protein S11 9606
108 6G53 11 L 40S ribosomal protein S11 9606
109 6G18 21 L 40S ribosomal protein S11 9606
110 6FYX 15 L KLLA0A10483p 28985
111 6FYY 15 L KLLA0A10483p 28985
112 6FEC 12 G 40S ribosomal protein S11 9606
113 6FAI 22 L 40S ribosomal protein S11-A 4932
114 6EML 20 X 40S ribosomal protein S11-A 4932
115 6EK0 57 SL 40S ribosomal protein S11 9606
116 6AZ1 21 U ribosomal protein S17 5661
117 5OQL 44 v 40S ribosomal protein S11-like protein 209285
118 5OPT 16 X 40S ribosomal protein S11, putative 5693
119 5WLC 12 LD rpS11_uS17 4932
120 5XYI 13 L Uncharacterized protein 5722
121 5XXU 13 L Ribosomal protein uS17 5811
122 5OA3 16 L 40S ribosomal protein S11 9606
123 5WYJ 42 SM 40S ribosomal protein S11-A 4932
124 5WYK 39 SM 40S ribosomal protein S11-A 4932
125 5TZS 13 D rpS11_uS17 4932
126 5MC6 25 X 40S ribosomal protein S11-A 4932
127 5M1J 19 L2 40S ribosomal protein S11-A 4932
128 5LZS 62 LL uS17 9986
129 5LZT 63 LL uS17 9986
130 5LZU 62 LL uS17 9986
131 5LZV 63 LL uS17 9986
132 5LZW 63 LL uS17 9986
133 5LZX 63 LL uS17 9986
134 5LZY 61 LL uS17 9986
135 5LZZ 63 LL uS17 9986
136 5T2A 61 AE uS17 5661
137 5T2C 73 Aw 40S ribosomal protein S11 9606
138 5LL6 10 X 40S ribosomal protein S11-A 4932
139 5LKS 56 SL 40S ribosomal protein S11 9606
140 5K0Y 5 G ribosomal protein uS17 9986
141 5JUO 61 IB uS17 (yeast S11) 4932
142 5JUP 61 IB uS17 (yeast S11) 4932
143 5JUS 61 IB uS17 (yeast S11) 4932
144 5JUT 61 IB uS17 (yeast S11) 4932
145 5JUU 61 IB uS17 (yeast S11) 4932
146 5JPQ 31 y uS17 209285
147 5IT7 59 L KLLA0A10483p 28985
148 5IT9 12 L Ribosomal protein uS17 28985
149 5FLX 13 L 40S RIBOSOMAL PROTEIN S11 9986
150 3JBN 31 V 40S ribosomal protein uS17 5833
151 3JBO 8 V 40S ribosomal protein uS17 5833
152 3JBP 31 V 40S ribosomal protein uS17 5833
153 3JAP 15 L uS17 28985
154 3JAQ 15 L uS17 28985
155 3JAM 13 L uS17 28985
156 3JAN 62 SL Ribosomal protein uS17 SEE REMARK 999 9986
157 3JAJ 63 SL Ribosomal protein uS17 SEE REMARK 999 9986
158 3JAG 63 LL uS17 9986
159 3JAH 63 LL uS17 9986
160 3JAI 63 LL uS17 9986
161 5A2Q 14 L RIBOSOMAL PROTEIN US17 9606
162 4UG0 57 SL 40S RIBOSOMAL PROTEIN S11 9606
163 5AJ0 61 BL 40S ribosomal protein S11 9606
164 4UER 27 Q US17 4934
165 4D61 13 L 40S RIBOSOMAL PROTEIN S11 9986
166 4D5L 13 L 40S RIBOSOMAL PROTEIN US17 9986
167 3J81 13 L uS17 28985
168 3J80 10 L uS17 28985
169 3J7P 61 SL Ribosomal protein uS17 9823
170 3J7R 62 SL Ribosomal protein uS17 9823
171 4UJC 62 CL 40S RIBOSOMAL PROTEIN US17 9986
172 4UJD 62 CL 40S RIBOSOMAL PROTEIN US17 9986
173 3J7A 22 V 40S ribosomal protein uS17 5833
174 3J77 57 11 40S ribosomal protein S11 4932
175 3J78 57 11 40S ribosomal protein S11 4932
176 3J6X 58 11 40S ribosomal protein S11 4932
177 3J6Y 58 11 40S ribosomal protein S11 4932
178 4UJE 16 BL 40S RIBOSOMAL PROTEIN S11 9986
179 4V92 14 BL US17 28985
180 4V7E 19 BL 40S ribosomal protein S17 4565
181 4V8Y 20 AL 40S RIBOSOMAL PROTEIN S11-A 4932
182 4V8Z 20 AL 40S RIBOSOMAL PROTEIN S11-A 4932
183 4V6W 11 AL 40S ribosomal protein S11 7227
184 4V6X 11 AL 40S ribosomal protein S11 9606
185 4V8M 13 AE 40S RIBOSOMAL PROTEINS S11, PUTATIVE 185431
186 4V6I 18 AP 40S ribosomal protein rpS11 (S17p) 4932
187 4V5Z 23 Aq 40S Ribosomal protein S11e 9612