6RXV

Cryo-EM structure of the 90S pre-ribosome (Kre33-Noc4) from Chaetomium thermophilum, state B2


Sequence Similarity Clusters for the Entities in PDB 6RXV

Entity #1 | Chains: UA
Periodic tryptophan protein 2-like protein protein, length: 904 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 12918
95 % 3 7 13298
90 % 3 7 13117
70 % 3 7 12413
50 % 3 11 7398
40 % 3 11 7127
30 % 3 11 6692
Entity #10 | Chains: UM
Utp13 protein, length: 912 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 12513
95 % 3 7 12448
90 % 3 7 12265
70 % 3 7 11653
50 % 3 7 10659
40 % 3 7 10029
30 % 3 7 9279
Entity #11 | Chains: UN
Utp14 protein, length: 938 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 12876
95 % 3 7 13204
90 % 3 7 13016
70 % 3 7 12312
50 % 3 7 11289
40 % 3 7 10616
30 % 3 7 9795
Entity #12 | Chains: UO
Utp15 protein, length: 557 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13103
95 % 3 7 12451
90 % 3 7 12267
70 % 3 7 11778
50 % 3 7 10662
40 % 3 7 10136
30 % 3 9 7858
Entity #13 | Chains: UQ
Utp17 protein, length: 960 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 12514
95 % 3 7 12708
90 % 3 7 12266
70 % 3 7 11654
50 % 3 7 10660
40 % 3 7 10231
30 % 3 7 9280
Entity #14 | Chains: UR
Utp18 protein, length: 618 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13015
95 % 3 7 12430
90 % 3 7 12243
70 % 3 7 11635
50 % 3 7 10639
40 % 3 7 10013
30 % 3 11 6523
Entity #15 | Chains: UU
Utp21 protein, length: 1049 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13337
95 % 3 7 13036
90 % 3 7 12864
70 % 3 7 12175
50 % 3 7 11140
40 % 3 7 10476
30 % 3 7 9678
Entity #16 | Chains: UX
Utp24 protein, length: 193 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 8 11065
95 % 3 8 11491
90 % 3 8 11356
70 % 3 8 10881
50 % 3 12 6905
40 % 3 12 6655
30 % 3 12 6284
Entity #17 | Chains: UZ
Utp30 protein, length: 391 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 12515
95 % 3 7 12449
90 % 3 7 12525
70 % 3 7 11655
50 % 3 7 10661
40 % 3 7 10030
30 % 3 7 9281
Entity #18 | Chains: CA,CB
Nop1 protein, length: 313 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 5317
95 % 3 7 6036
90 % 3 7 6056
70 % 3 7 5963
50 % 3 11 3612
40 % 3 11 3592
30 % 3 11 3513
Entity #19 | Chains: CC
Nop56 protein, length: 523 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13102
95 % 3 7 12579
90 % 3 7 12403
70 % 3 7 11777
50 % 3 11 7196
40 % 3 14 5673
30 % 3 14 5210
Entity #2 | Chains: UB
Utp2 protein, length: 907 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13048
95 % 3 7 12941
90 % 3 7 12307
70 % 3 7 12087
50 % 3 7 10702
40 % 3 7 10064
30 % 3 7 9309
Entity #20 | Chains: CD
Nop58 protein, length: 582 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13533
95 % 3 7 13374
90 % 3 7 13192
70 % 3 7 12501
50 % 3 7 11447
40 % 3 7 10764
30 % 3 7 9927
Entity #21 | Chains: CE,CF
Snu13 protein, length: 127 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 4988
95 % 3 7 6237
90 % 3 7 6250
70 % 3 7 5850
50 % 12 34 1337
40 % 13 35 1317
30 % 12 34 1420
Entity #22 | Chains: CG
Rrp9 protein, length: 630 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13051
95 % 3 7 12641
90 % 3 7 12309
70 % 3 7 11695
50 % 3 7 10706
40 % 3 7 10067
30 % 3 7 9314
Entity #23 | Chains: CH
RNA 3'-terminal phosphate cyclase-like protein protein, length: 411 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 12913
95 % 3 7 13292
90 % 3 7 13108
70 % 3 7 12405
50 % 3 7 11373
40 % 3 7 10694
30 % 3 7 9870
Entity #24 | Chains: CI
Bms1 protein, length: 1163 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13306
95 % 3 7 12987
90 % 3 7 12809
70 % 3 7 12125
50 % 3 7 11097
40 % 3 11 7155
30 % 3 11 6716
Entity #25 | Chains: CJ
Imp3 protein, length: 183 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 8 10822
95 % 3 8 10276
90 % 3 8 10170
70 % 3 8 9834
50 % 3 12 6954
40 % 3 12 6125
30 % 3 12 5822
Entity #26 | Chains: CK
Imp4 protein, length: 297 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 8 9950
95 % 3 8 10693
90 % 3 8 10577
70 % 3 8 10191
50 % 3 11 7432
40 % 3 11 7154
30 % 3 11 6715
Entity #27 | Chains: CL
Mpp10 protein, length: 785 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13039
95 % 3 7 13291
90 % 3 7 12298
70 % 3 7 12404
50 % 3 7 10697
40 % 3 7 10059
30 % 3 7 9868
Entity #28 | Chains: CM
Sof1 protein, length: 446 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13307
95 % 3 7 12988
90 % 3 7 12810
70 % 3 7 12126
50 % 3 7 11098
40 % 3 9 8347
30 % 3 9 7791
Entity #29 | Chains: CN,CO
Emg1 protein, length: 252 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 5339
95 % 3 7 5730
90 % 3 7 6100
70 % 8 17 2343
50 % 8 17 2360
40 % 8 17 2409
30 % 8 17 2399
Entity #3 | Chains: UC
Utp3 protein, length: 648 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 12917
95 % 3 7 13297
90 % 3 7 13116
70 % 3 7 12412
50 % 3 7 11380
40 % 3 7 10699
30 % 3 7 9875
Entity #30 | Chains: CP
KRR1 small subunit processome component protein, length: 322 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 8 9517
95 % 3 8 10021
90 % 3 8 9932
70 % 3 11 7070
50 % 3 11 7010
40 % 3 11 6762
30 % 3 11 6359
Entity #31 | Chains: CQ
Pre-rRNA-processing protein PNO1 protein, length: 259 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13133
95 % 3 7 12637
90 % 3 7 12455
70 % 3 7 11818
50 % 3 7 10819
40 % 3 7 10171
30 % 3 7 9403
Entity #32 | Chains: CR,CS
Kre33 protein, length: 1073 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 8 4346
95 % 3 8 5230
90 % 3 8 5273
70 % 3 8 5228
50 % 3 8 5051
40 % 3 8 4912
30 % 3 8 4730
Entity #33 | Chains: CT
Fcf2 protein, length: 203 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 12665
95 % 3 7 12756
90 % 3 7 12581
70 % 3 7 11938
50 % 3 7 10930
40 % 3 7 10279
30 % 3 7 9499
Entity #34 | Chains: Ca
40S ribosomal protein S1 protein, length: 255 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 5 17927
95 % 3 5 16797
90 % 3 5 16503
70 % 46 86 470
50 % 51 142 350
40 % 53 149 346
30 % 53 149 362
Entity #35 | Chains: Cb
40S ribosomal protein S4 protein, length: 264 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 5 19368
95 % 2 5 17234
90 % 2 5 16910
70 % 50 168 264
50 % 52 178 259
40 % 52 182 260
30 % 52 187 261
Entity #36 | Chains: Cc
40S ribosomal protein s5-like protein protein, length: 212 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 12646
95 % 3 7 12719
90 % 3 7 13028
70 % 8 93 636
50 % 54 188 231
40 % 54 188 240
30 % 54 188 251
Entity #37 | Chains: Cd
40S ribosomal protein S6 protein, length: 239 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 5 19367
95 % 2 5 17411
90 % 2 5 16909
70 % 7 83 713
50 % 51 169 301
40 % 51 174 301
30 % 51 174 323
Entity #38 | Chains: Ce
40S ribosomal protein S7 protein, length: 203 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 12493
95 % 3 7 12405
90 % 3 7 12903
70 % 3 7 11612
50 % 51 175 282
40 % 51 175 294
30 % 53 178 294
Entity #39 | Chains: Cf
40S ribosomal protein S8 protein, length: 202 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 5 20214
95 % 2 5 18663
90 % 2 5 18282
70 % 45 88 459
50 % 52 177 262
40 % 52 181 262
30 % 52 181 283
Entity #4 | Chains: UD
Utp4 protein, length: 884 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 4 8 9242
95 % 4 8 9496
90 % 4 8 9405
70 % 4 8 9136
50 % 4 8 8498
40 % 4 8 8150
30 % 4 8 7605
Entity #40 | Chains: Cg
40S ribosomal protein s9-like protein protein, length: 190 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13243
95 % 3 7 12875
90 % 3 7 12696
70 % 52 172 258
50 % 54 187 232
40 % 54 191 236
30 % 54 191 248
Entity #41 | Chains: Ch
40S ribosomal protein S13-like protein protein, length: 151 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 12808
95 % 3 7 13058
90 % 3 7 12890
70 % 52 177 250
50 % 54 184 238
40 % 54 189 238
30 % 54 189 249
Entity #42 | Chains: Ci
40S ribosomal protein S14-like protein protein, length: 150 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13362
95 % 3 7 13072
90 % 7 73 799
70 % 54 185 219
50 % 54 186 233
40 % 54 186 244
30 % 54 186 262
Entity #43 | Chains: Cj
40S ribosomal protein S16-like protein protein, length: 143 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13110
95 % 3 7 12591
90 % 3 7 12416
70 % 3 7 11696
50 % 54 179 254
40 % 54 183 252
30 % 54 184 269
Entity #44 | Chains: Ck
40S ribosomal protein S11-like protein protein, length: 161 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 5 18667
95 % 2 5 18288
90 % 2 5 17686
70 % 46 90 443
50 % 53 184 236
40 % 53 184 246
30 % 53 184 265
Entity #45 | Chains: Cm
40S ribosomal protein S22-like protein protein, length: 130 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13513
95 % 3 7 12830
90 % 3 7 12646
70 % 53 188 225
50 % 55 191 230
40 % 55 191 237
30 % 414 752 23
Entity #46 | Chains: Cn
40S ribosomal protein s23-like protein protein, length: 145 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13244
95 % 3 7 12876
90 % 3 7 12697
70 % 54 191 210
50 % 54 197 220
40 % 54 197 229
30 % 54 197 243
Entity #47 | Chains: Co
40S ribosomal protein S24 protein, length: 136 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 5 20231
95 % 2 5 18236
90 % 2 5 17372
70 % 45 90 447
50 % 50 179 267
40 % 50 179 282
30 % 50 179 305
Entity #48 | Chains: Cp
40S ribosomal protein S28-like protein protein, length: 68 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13111
95 % 3 7 12592
90 % 3 7 12417
70 % 52 178 248
50 % 54 185 234
40 % 54 186 242
30 % 54 186 258
Entity #49 | Chains: CU
Faf1 protein, length: 311 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13112
95 % 3 7 12593
90 % 3 7 12418
70 % 3 7 11788
50 % 3 7 10785
40 % 3 7 10145
30 % 3 7 9385
Entity #5 | Chains: UF
Utp6 protein, length: 414 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13531
95 % 3 7 12936
90 % 3 7 13239
70 % 3 7 12494
50 % 3 7 11442
40 % 3 7 10758
30 % 3 7 9923
Entity #50 | Chains: C1
35S ribosomal RNA rna, length: 2352 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
Entity #51 | Chains: C2
U3 snoRNA rna, length: 230 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
Entity #52 | Chains: UV
U3 small nucleolar RNA-associated protein 22 protein, length: 1171 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 4 29982
95 % 1 4 22129
90 % 1 4 21543
70 % 1 4 19410
50 % 1 4 17574
40 % 1 4 16216
30 % 1 4 14437
Entity #53 | Chains: CV
Rrp7 protein, length: 322 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 4 25398
95 % 1 4 25613
90 % 1 4 24784
70 % 1 4 22603
50 % 1 4 20084
40 % 1 4 18244
30 % 1 4 16498
Entity #54 | Chains: CW
Ribosome biogenesis protein ENP2 protein, length: 668 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 4 28370
95 % 2 4 23005
90 % 2 4 22370
70 % 2 4 20472
50 % 2 4 18164
40 % 2 4 16715
30 % 2 4 15064
Entity #55 | Chains: UT
Utp20 protein, length: 2612 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 4 30308
95 % 2 4 25867
90 % 2 4 25014
70 % 2 4 22796
50 % 2 4 20082
40 % 2 4 18384
30 % 2 4 16496
Entity #56 | Chains: UH
Utp8 protein, length: 930 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 6 17784
95 % 3 6 16647
90 % 3 6 15089
70 % 3 6 15274
50 % 3 6 13824
40 % 3 6 12863
30 % 3 6 11752
Entity #57 | Chains: UE,UI
Utp5 protein, length: 410 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 6 7103
95 % 3 6 7748
90 % 3 6 7676
70 % 3 6 7483
50 % 3 6 7038
40 % 3 6 6793
30 % 3 6 6402
Entity #58 | Chains: US
Noc4 protein, length: 549 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 6 17783
95 % 3 6 14379
90 % 3 6 16355
70 % 3 6 15273
50 % 3 6 13823
40 % 3 6 12862
30 % 3 6 11751
Entity #59 | Chains: Cl
Rps18 protein, length: 156 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 6 16324
95 % 3 6 14341
90 % 3 6 14121
70 % 52 170 260
50 % 54 179 252
40 % 54 185 245
30 % 54 185 263
Entity #6 | Chains: UG
Utp7 protein, length: 558 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13558
95 % 3 7 13404
90 % 3 7 13223
70 % 3 7 12532
50 % 3 7 11471
40 % 3 9 8106
30 % 3 9 7573
Entity #60 | Chains: CX
Enp1 protein, length: 480 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 6 16325
95 % 3 6 14342
90 % 3 6 14122
70 % 3 6 13330
50 % 3 6 12161
40 % 3 6 11406
30 % 3 14 5378
Entity #61 | Chains: CY
U3 small nucleolar ribonucleoprotein protein lcp5-like protein protein, length: 381 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 3 34938
95 % 2 3 27653
90 % 2 3 26685
70 % 2 3 24209
50 % 2 3 21275
40 % 2 3 19425
30 % 2 3 17425
Entity #62 | Chains: CZ
Bfr2 protein, length: 609 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 4 24873
95 % 2 4 25180
90 % 2 4 24374
70 % 2 4 22242
50 % 2 4 19631
40 % 2 4 18003
30 % 2 4 16159
Entity #63 | Chains: UP
Utp16 protein, length: 364 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 6 16872
95 % 3 6 15223
90 % 3 6 14959
70 % 3 6 14073
50 % 3 6 12818
40 % 3 6 11978
30 % 3 6 10972
Entity #7 | Chains: UJ
UTP10 protein, length: 1802 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 8 10365
95 % 3 8 11317
90 % 3 8 11186
70 % 3 8 10741
50 % 3 8 9905
40 % 3 8 9395
30 % 3 8 8699
Entity #8 | Chains: UK
U3 small nucleolar RNA-associated protein 11 protein, length: 270 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13530
95 % 3 7 13369
90 % 3 7 13186
70 % 3 7 12493
50 % 3 7 11441
40 % 3 7 10757
30 % 3 7 9922
Entity #9 | Chains: UL
Utp12 protein, length: 962 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13529
95 % 3 7 13368
90 % 3 7 13185
70 % 3 7 12492
50 % 3 7 11440
40 % 3 11 6857
30 % 3 11 6524

Instructions

In the table for each entity, view a list of similar sequences by selecting the link associated with the percentage cutoff.



View more detailed documentation on the redundancy reduction and sequence clustering procedure used by RCSB PDB.

You can also use the structure comparison tool to compare any 2 given structures


ACTION - (A) Select for download / view details OR (B) Select two chains for comparison
Rank PDB ID Entity ID Chains Description Details Taxonomy EC Number
1 4V88 13 AL, CL 40S ribosomal protein S11-A 4932
2 4U4R 13 C1, c1 40S ribosomal protein S11-A 4932
3 4U3U 13 C1, c1 40S ribosomal protein S11-A 4932
4 5TBW 60 M, c1 40S ribosomal protein S11-A 4932
5 4U3M 13 C1, c1 40S ribosomal protein S11-A 4932
6 4U3N 13 C1, c1 40S ribosomal protein S11-A 4932
7 4U52 13 C1, c1 40S ribosomal protein S11-A 4932
8 4U4Q 13 C1, c1 40S ribosomal protein S11-A 4932
9 4U6F 13 C1, c1 40S ribosomal protein S11-A 4932
10 4U4U 13 C1, c1 40S ribosomal protein S11-A 4932
11 4U4Z 13 C1, c1 40S ribosomal protein S11-A 4932
12 4U4Y 13 C1, c1 40S ribosomal protein S11-A 4932
13 4U4N 13 C1, c1 40S ribosomal protein S11-A 4932
14 4U55 13 C1, c1 40S ribosomal protein S11-A 4932
15 5DAT 13 C1, c1 40S ribosomal protein S11-A 4932
16 5I4L 13 C1, c1 40S ribosomal protein S11-A 4932
17 4U51 13 C1, c1 40S ribosomal protein S11-A 4932
18 6HHQ 59 M, c1 40S ribosomal protein S11-A 4932
19 5OBM 57 C1, c1 40S ribosomal protein S11-A 4932
20 4U53 13 C1, c1 40S ribosomal protein S11-A 4932
21 5ON6 61 M, c1 40S ribosomal protein S11-A 4932
22 4U50 13 C1, c1 40S ribosomal protein S11-A 4932
23 5NDV 57 C1, c1 40S ribosomal protein S11-A 4932
24 5LYB 13 C1, c1 40S ribosomal protein S11-A,40S ribosomal protein S11-A,40S Ribosomal Protein S11-A 4932
25 4U56 13 C1, c1 40S ribosomal protein S11-A 4932
26 5TGA 13 C1, c1 40S ribosomal protein S11-A 4932
27 5MEI 60 M, c1 40S ribosomal protein S11-A 4932
28 5FCJ 13 C1, c1 40S ribosomal protein S11-A,40S ribosomal protein S11-A,40S ribosomal protein S11-A,40S ribosomal protein S11-A,40S ribosomal protein S11-A (uS17) (UNK) residues correspond to residues that aren't well resolved, and for which side-chains could not be modeled. (UNK)s were substituted in the original sequence of the crystallized protein. Remaining misalignments result from differences in the distribution of (UNK)s between the two instances of the molecule in the structure. Here is the original sequence ot the crystallized protein : STELTVQSERAFQKQPHIFNNPKVKTSKRTKRWYKNAGLGFKTPKTAIEGSYIDKKCPFTGLVSIRGKILTGTVVSTKMH RTIVIRRAYLHYIPKYNRYEKRHKNVPVHVSPAFRVQVGDIVTVGQCRPISKTVRFNVVKVSAAAAKANKQFAKF 4932
29 4U4O 13 C1, c1 40S ribosomal protein S11-A 4932
30 5DGV 13 C1, c1 40S ribosomal protein S11-A 4932
31 5DGE 13 C1, c1 40S ribosomal protein S11-A 4932
32 5NDW 6 C1, c1 40S ribosomal protein S11-A 4932
33 4BTS 27 AQ, BQ, CQ, DQ 40S RIBOSOMAL PROTEIN RPS11E 5911
34 5NDG 13 C1, c1 40S ribosomal protein S11-A 4932
35 5FCI 13 C1, c1 40S ribosomal protein S11-A,40S ribosomal protein S11-A (uS17) (UNK) residues correspond to residues that aren't well resolved, and for which side-chains could not be modeled. (UNK)s were substituted in the original sequence of the crystallized protein. Remaining misalignments result from differences in the distribution of (UNK)s between the two instances of the molecule in the structure. Here is the original sequence ot the crystallized protein : STELTVQSERAFQKQPHIFNNPKVKTSKRTKRWYKNAGLGFKTPKTAIEGSYIDKKCPFTGLVSIRGKILTGTVVSTKMH RTIVIRRAYLHYIPKYNRYEKRHKNVPVHVSPAFRVQVGDIVTVGQCRPISKTVRFNVVKVSAAAAKANKQFAKF 4932
36 5DC3 13 C1, c1 40S ribosomal protein S11-A 4932
37 5DGF 13 C1, c1 40S ribosomal protein S11-A 4932
38 4V5O 26 AQ, BQ RIBOSOMAL PROTEIN S17 CONTAINING PROTEIN 5911
39 5TGM 13 C1, c1 40S ribosomal protein S11-A,40S Ribosomal Protein S11 4932
40 4V7R 7 AF, CF 40S ribosomal protein S11 4932
41 5VYC 30 L1, L2, L3, L4, L5, L6 40S ribosomal protein S11 9606
42 4KZZ 12 L 40S Ribosomal Protein S11 9986
43 4KZX 12 L 40S ribosomal protein S11 9986
44 4KZY 12 L 40S Ribosomal Protein S11 9986
45 6UZ7 59 L KLLA0A10483p 28985
46 6T83 14 Lb, m 40S ribosomal protein S11-A 4932
47 6T7T 14 SL 40S ribosomal protein S11-A 4932
48 6T7I 14 SL 40S ribosomal protein S11-A 4932
49 6T4Q 13 SL 40S ribosomal protein S11-A 4932
50 6SGC 13 M1 Ribosomal protein S11 9986
51 6S47 57 BM 40S ribosomal protein S11-A 4932
52 6RXU 44 Ck 40S ribosomal protein S11-like protein 209285
53 6RXV 44 Ck 40S ribosomal protein S11-like protein 209285
54 6RXX 41 Ck 40S ribosomal protein S11-like protein 209285
55 6RXZ 43 Ck 40S ribosomal protein S11-like protein 209285
56 6P5I 13 M uS17 9986
57 6P5J 13 M uS17 9986
58 6P5K 59 M uS17 9986
59 6P5N 59 M uS17 9986
60 6P4G 13 M uS17 9986
61 6P4H 14 M uS17 9986
62 6OM7 10 SL 40S ribosomal protein S11 9606
63 6OLZ 58 BL 40S ribosomal protein S11 9606
64 6OM0 10 SL 40S ribosomal protein S11 9606
65 6OLE 10 SL 40S ribosomal protein S11 9606
66 6OLF 10 SL 40S ribosomal protein S11 9606
67 6OLG 61 BL 40S ribosomal protein S11 9606
68 6OLI 10 SL 40S ribosomal protein S11 9606
69 6OKK 22 V 40S ribosomal protein S11 5833
70 6RBD 12 L 40S ribosomal protein S11-A 4932
71 6RBE 10 L 40S ribosomal protein S11-A 4932
72 6R7Q 5 EE Ribosomal protein S11 9986
73 6R6G 19 EE Ribosomal protein S11 9986
74 6R6P 60 EE Ribosomal protein S11 9986
75 6R5Q 63 EE Ribosomal protein S11 9986
76 6QZP 57 SL 40S ribosomal protein S11 9606
77 6Q8Y 79 X 40S ribosomal protein S11-A 4932
78 6I7O 30 X, Xb 40S ribosomal protein S11-A 4932
79 6IP5 56 2v 40S ribosomal protein S11 9606
80 6IP6 55 2v 40S ribosomal protein S11 9606
81 6IP8 55 2v 40S ribosomal protein S11 9606
82 6MTB 62 LL 40S ribosomal protein S11 9986
83 6MTC 61 LL 40S ribosomal protein S11 9986
84 6MTD 63 LL uS17 9986
85 6MTE 62 LL uS17 9986
86 6HCQ 16 M2 Ribosomal protein S11 9986
87 6HCJ 16 M2 Ribosomal protein S11 9986
88 6HCM 13 M1 Ribosomal protein S11 9986
89 6HCF 13 M1 Ribosomal protein S11 9986
90 6GZ3 29 BL Ribosomal protein S11 9986
91 6GZ4 32 BL ribosomal protein uS17 9986
92 6GZ5 29 BL ribosomal protein uS17 9986
93 6GSM 15 L KLLA0A10483p 28985
94 6GSN 36 L KLLA0A10483p 28985
95 6GQV 59 AB 40S ribosomal protein S11-A 4932
96 6GQ1 59 AB 40S ribosomal protein S11-A 4932
97 6GQB 59 AB 40S ribosomal protein S11-A 4932
98 6D9J 61 MM uS17 9986
99 6D90 62 MM uS17 9986
100 6G5H 10 L 40S ribosomal protein S11 9606
101 6G5I 13 L 40S ribosomal protein S11 9606
102 6G4S 29 L 40S ribosomal protein S11 9606
103 6G4W 25 L 40S ribosomal protein S11 9606
104 6G51 11 L 40S ribosomal protein S11 9606
105 6G53 11 L 40S ribosomal protein S11 9606
106 6G18 21 L 40S ribosomal protein S11 9606
107 6FYX 15 L KLLA0A10483p 28985
108 6FYY 15 L KLLA0A10483p 28985
109 6FEC 12 G 40S ribosomal protein S11 9606
110 6FAI 22 L 40S ribosomal protein S11-A 4932
111 6EML 20 X 40S ribosomal protein S11-A 4932
112 6EK0 57 SL 40S ribosomal protein S11 9606
113 6AZ1 21 U ribosomal protein S17 5661
114 5OQL 44 v 40S ribosomal protein S11-like protein 209285
115 5OPT 16 X 40S ribosomal protein S11, putative 5693
116 5WLC 12 LD rpS11_uS17 4932
117 5XYI 13 L Uncharacterized protein 5722
118 5XXU 13 L Ribosomal protein uS17 5811
119 5OA3 16 L 40S ribosomal protein S11 9606
120 5WYJ 42 SM 40S ribosomal protein S11-A 4932
121 5WYK 39 SM 40S ribosomal protein S11-A 4932
122 5TZS 13 D rpS11_uS17 4932
123 5MC6 25 X 40S ribosomal protein S11-A 4932
124 5M1J 19 L2 40S ribosomal protein S11-A 4932
125 5LZS 62 LL uS17 9986
126 5LZT 63 LL uS17 9986
127 5LZU 62 LL uS17 9986
128 5LZV 63 LL uS17 9986
129 5LZW 63 LL uS17 9986
130 5LZX 63 LL uS17 9986
131 5LZY 61 LL uS17 9986
132 5LZZ 63 LL uS17 9986
133 5T2A 61 AE uS17 5661
134 5T2C 73 Aw 40S ribosomal protein S11 9606
135 5LL6 10 X 40S ribosomal protein S11-A 4932
136 5LKS 56 SL 40S ribosomal protein S11 9606
137 5K0Y 5 G ribosomal protein uS17 9986
138 5JUO 61 IB uS17 (yeast S11) 4932
139 5JUP 61 IB uS17 (yeast S11) 4932
140 5JUS 61 IB uS17 (yeast S11) 4932
141 5JUT 61 IB uS17 (yeast S11) 4932
142 5JUU 61 IB uS17 (yeast S11) 4932
143 5JPQ 31 y uS17 209285
144 5IT7 59 L KLLA0A10483p 28985
145 5IT9 12 L Ribosomal protein uS17 28985
146 5FLX 13 L 40S RIBOSOMAL PROTEIN S11 9986
147 3JBN 31 V 40S ribosomal protein uS17 5833
148 3JBO 8 V 40S ribosomal protein uS17 5833
149 3JBP 31 V 40S ribosomal protein uS17 5833
150 3JAP 15 L uS17 28985
151 3JAQ 15 L uS17 28985
152 3JAM 13 L uS17 28985
153 3JAN 62 SL Ribosomal protein uS17 SEE REMARK 999 9986
154 3JAJ 63 SL Ribosomal protein uS17 SEE REMARK 999 9986
155 3JAG 63 LL uS17 9986
156 3JAH 63 LL uS17 9986
157 3JAI 63 LL uS17 9986
158 5A2Q 14 L RIBOSOMAL PROTEIN US17 9606
159 4UG0 57 SL 40S RIBOSOMAL PROTEIN S11 9606
160 5AJ0 61 BL 40S ribosomal protein S11 9606
161 4UER 27 Q US17 4934
162 4D61 13 L 40S RIBOSOMAL PROTEIN S11 9986
163 4D5L 13 L 40S RIBOSOMAL PROTEIN US17 9986
164 3J81 13 L uS17 28985
165 3J80 10 L uS17 28985
166 3J7P 61 SL Ribosomal protein uS17 9823
167 3J7R 62 SL Ribosomal protein uS17 9823
168 4UJC 62 CL 40S RIBOSOMAL PROTEIN US17 9986
169 4UJD 62 CL 40S RIBOSOMAL PROTEIN US17 9986
170 3J7A 22 V 40S ribosomal protein uS17 5833
171 3J77 57 11 40S ribosomal protein S11 4932
172 3J78 57 11 40S ribosomal protein S11 4932
173 3J6X 58 11 40S ribosomal protein S11 4932
174 3J6Y 58 11 40S ribosomal protein S11 4932
175 4UJE 16 BL 40S RIBOSOMAL PROTEIN S11 9986
176 4V92 14 BL US17 28985
177 4V7E 19 BL 40S ribosomal protein S17 4565
178 4V8Y 20 AL 40S RIBOSOMAL PROTEIN S11-A 4932
179 4V8Z 20 AL 40S RIBOSOMAL PROTEIN S11-A 4932
180 4V6W 11 AL 40S ribosomal protein S11 7227
181 4V6X 11 AL 40S ribosomal protein S11 9606
182 4V8M 13 AE 40S RIBOSOMAL PROTEINS S11, PUTATIVE 185431
183 4V6I 18 AP 40S ribosomal protein rpS11 (S17p) 4932
184 4V5Z 23 Aq 40S Ribosomal protein S11e 9612