6RXV

Cryo-EM structure of the 90S pre-ribosome (Kre33-Noc4) from Chaetomium thermophilum, state B2


Sequence Similarity Clusters for the Entities in PDB 6RXV

Entity #1 | Chains: UA
Periodic tryptophan protein 2-like protein protein, length: 904 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 14883
95 % 3 7 14677
90 % 3 7 14466
70 % 3 7 13610
50 % 17 25 3459
40 % 17 25 3432
30 % 17 25 3385
Entity #10 | Chains: UM
Utp13 protein, length: 912 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 14658
95 % 3 7 14241
90 % 3 7 14032
70 % 3 7 13208
50 % 3 7 12041
40 % 3 7 11304
30 % 3 7 10410
Entity #11 | Chains: UN
Utp14 protein, length: 938 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 14399
95 % 3 7 13728
90 % 3 7 13534
70 % 3 7 12755
50 % 3 7 11619
40 % 3 7 10909
30 % 3 7 10068
Entity #12 | Chains: UO
Utp15 protein, length: 557 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 14141
95 % 3 7 14432
90 % 3 7 14232
70 % 3 7 13376
50 % 3 7 12189
40 % 3 7 11449
30 % 16 22 3743
Entity #13 | Chains: UQ
Utp17 protein, length: 960 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 14400
95 % 3 7 13729
90 % 3 7 13535
70 % 3 7 12756
50 % 3 7 11620
40 % 3 7 10910
30 % 3 7 10069
Entity #14 | Chains: UR
Utp18 protein, length: 618 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 14140
95 % 3 7 14431
90 % 3 7 14231
70 % 3 7 13375
50 % 3 7 12188
40 % 3 7 11448
30 % 16 24 3403
Entity #15 | Chains: UU
Utp21 protein, length: 1049 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13969
95 % 3 7 14088
90 % 3 7 13868
70 % 3 7 13067
50 % 3 7 11917
40 % 3 7 11177
30 % 3 7 10302
Entity #16 | Chains: UX
Utp24 protein, length: 193 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 8 13288
95 % 3 8 12505
90 % 3 8 12376
70 % 3 8 11773
50 % 17 26 3268
40 % 17 26 3249
30 % 17 26 3209
Entity #17 | Chains: UZ
Utp30 protein, length: 391 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13721
95 % 3 7 13580
90 % 3 7 13398
70 % 3 7 12649
50 % 3 7 11514
40 % 3 7 10809
30 % 3 7 9967
Entity #18 | Chains: CA,CB
Nop1 protein, length: 313 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 5936
95 % 3 7 6657
90 % 3 7 6677
70 % 3 7 6592
50 % 16 24 1667
40 % 16 24 1699
30 % 16 24 1735
Entity #19 | Chains: CC
Nop56 protein, length: 523 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 14273
95 % 3 7 14087
90 % 3 7 13867
70 % 3 7 13392
50 % 16 24 3503
40 % 29 41 2013
30 % 29 41 2031
Entity #2 | Chains: UB
Utp2 protein, length: 907 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 14882
95 % 3 7 14676
90 % 3 7 14465
70 % 3 7 13609
50 % 3 7 12417
40 % 3 7 11645
30 % 3 7 10712
Entity #20 | Chains: CD
Nop58 protein, length: 582 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 14447
95 % 3 7 14176
90 % 3 7 13957
70 % 3 7 13133
50 % 3 7 11976
40 % 3 7 11237
30 % 3 7 10349
Entity #21 | Chains: CE,CF
Snu13 protein, length: 127 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 5711
95 % 3 7 6802
90 % 3 7 6812
70 % 3 7 6715
50 % 25 47 959
40 % 26 48 963
30 % 25 47 1028
Entity #22 | Chains: CG
Rrp9 protein, length: 630 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 14707
95 % 3 7 14342
90 % 3 7 13417
70 % 3 7 12663
50 % 3 7 11526
40 % 3 7 10822
30 % 3 7 9981
Entity #23 | Chains: CH
RNA 3'-terminal phosphate cyclase-like protein protein, length: 411 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 14624
95 % 3 7 14177
90 % 3 7 13958
70 % 3 7 13134
50 % 3 7 11977
40 % 3 7 11238
30 % 3 7 10350
Entity #24 | Chains: CI
Bms1 protein, length: 1163 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 14706
95 % 3 7 13602
90 % 3 7 14135
70 % 3 7 13301
50 % 3 7 12123
40 % 18 26 3310
30 % 18 26 3282
Entity #25 | Chains: CJ
Imp3 protein, length: 183 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 8 13289
95 % 3 8 12829
90 % 3 8 12674
70 % 3 8 12033
50 % 17 26 3205
40 % 17 26 3189
30 % 17 26 3152
Entity #26 | Chains: CK
Imp4 protein, length: 297 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 8 12978
95 % 3 8 12376
90 % 3 8 12249
70 % 3 8 11677
50 % 18 26 3329
40 % 18 26 3231
30 % 18 26 3273
Entity #27 | Chains: CL
Mpp10 protein, length: 785 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 14120
95 % 3 7 14390
90 % 3 7 14185
70 % 3 7 13332
50 % 3 7 12152
40 % 3 7 11414
30 % 3 7 10502
Entity #28 | Chains: CM
Sof1 protein, length: 446 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13970
95 % 3 7 14089
90 % 3 7 13870
70 % 3 7 13068
50 % 3 7 11919
40 % 15 21 4092
30 % 15 21 3988
Entity #29 | Chains: CN,CO
Emg1 protein, length: 252 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 5542
95 % 3 7 6730
90 % 3 7 6743
70 % 23 32 1261
50 % 23 32 1305
40 % 23 32 1346
30 % 23 32 1378
Entity #3 | Chains: UC
Utp3 protein, length: 648 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 14854
95 % 3 7 14625
90 % 3 7 14423
70 % 3 7 13569
50 % 3 7 12379
40 % 3 7 11607
30 % 18 23 3608
Entity #30 | Chains: CP
KRR1 small subunit processome component protein, length: 322 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 8 9658
95 % 3 8 10462
90 % 3 8 10376
70 % 10 18 4659
50 % 10 18 4558
40 % 10 18 4430
30 % 10 18 4324
Entity #31 | Chains: CQ
Pre-rRNA-processing protein PNO1 protein, length: 259 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 14850
95 % 3 7 14621
90 % 3 7 14417
70 % 3 7 13564
50 % 3 7 12374
40 % 3 7 11602
30 % 3 7 10677
Entity #32 | Chains: CR,CS
Kre33 protein, length: 1073 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 8 4900
95 % 3 8 5525
90 % 3 8 5561
70 % 3 8 5846
50 % 11 16 2682
40 % 11 16 2668
30 % 11 16 2660
Entity #33 | Chains: CT
Fcf2 protein, length: 203 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 14469
95 % 3 7 13888
90 % 3 7 13687
70 % 3 7 12893
50 % 3 7 11748
40 % 3 7 11026
30 % 3 7 10609
Entity #34 | Chains: Ca
40S ribosomal protein S1 protein, length: 255 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 5 22096
95 % 3 5 20293
90 % 3 5 19841
70 % 73 113 421
50 % 107 199 284
40 % 107 203 287
30 % 107 203 298
Entity #35 | Chains: Cb
40S ribosomal protein S4 protein, length: 264 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 5 20065
95 % 2 5 18406
90 % 2 5 18689
70 % 108 226 235
50 % 109 238 236
40 % 111 241 233
30 % 118 260 232
Entity #36 | Chains: Cc
40S ribosomal protein s5-like protein protein, length: 212 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 14851
95 % 3 7 14622
90 % 3 7 14418
70 % 38 123 522
50 % 114 248 218
40 % 114 248 225
30 % 114 259 233
Entity #37 | Chains: Cd
40S ribosomal protein S6 protein, length: 239 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 5 22094
95 % 2 5 20292
90 % 2 5 19840
70 % 2 5 18331
50 % 109 226 251
40 % 109 230 249
30 % 109 230 257
Entity #38 | Chains: Ce
40S ribosomal protein S7 protein, length: 203 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 14471
95 % 3 7 13890
90 % 3 7 13689
70 % 3 7 12901
50 % 110 234 242
40 % 110 234 245
30 % 112 237 245
Entity #39 | Chains: Cf
40S ribosomal protein S8 protein, length: 202 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 5 20064
95 % 2 5 19063
90 % 2 5 18687
70 % 74 117 401
50 % 110 235 235
40 % 110 239 236
30 % 110 239 243
Entity #4 | Chains: UD
Utp4 protein, length: 884 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 4 8 10367
95 % 4 8 10619
90 % 4 8 10838
70 % 4 8 10196
50 % 4 8 9409
40 % 4 8 9036
30 % 4 8 8438
Entity #40 | Chains: Cg
40S ribosomal protein s9-like protein protein, length: 190 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13875
95 % 3 7 13872
90 % 3 7 13669
70 % 111 231 232
50 % 114 247 220
40 % 121 258 214
30 % 121 258 225
Entity #41 | Chains: Ch
40S ribosomal protein S13-like protein protein, length: 151 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 14470
95 % 3 7 13889
90 % 3 7 13688
70 % 112 237 226
50 % 114 244 226
40 % 121 256 217
30 % 121 256 226
Entity #42 | Chains: Ci
40S ribosomal protein S14-like protein protein, length: 150 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 14675
95 % 3 7 13796
90 % 36 102 640
70 % 112 243 216
50 % 112 244 225
40 % 112 244 230
30 % 112 244 236
Entity #43 | Chains: Cj
40S ribosomal protein S16-like protein protein, length: 143 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 14117
95 % 3 7 14063
90 % 3 7 14104
70 % 3 7 13041
50 % 111 236 234
40 % 118 247 226
30 % 118 248 234
Entity #44 | Chains: Ck
40S ribosomal protein S11-like protein protein, length: 161 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 5 21691
95 % 2 5 19669
90 % 2 5 19259
70 % 75 119 387
50 % 112 243 227
40 % 112 243 231
30 % 112 243 239
Entity #45 | Chains: Cm
40S ribosomal protein S22-like protein protein, length: 130 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 14505
95 % 3 7 13754
90 % 3 7 13560
70 % 112 247 217
50 % 122 261 201
40 % 122 265 209
30 % 572 915 20
Entity #46 | Chains: Cn
40S ribosomal protein s23-like protein protein, length: 145 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 14343
95 % 3 7 13736
90 % 3 7 13543
70 % 114 257 206
50 % 121 264 193
40 % 121 264 201
30 % 121 264 216
Entity #47 | Chains: Co
40S ribosomal protein S24 protein, length: 136 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 5 21690
95 % 2 5 19668
90 % 2 5 19258
70 % 2 5 17806
50 % 108 237 239
40 % 109 238 242
30 % 109 238 251
Entity #48 | Chains: Cp
40S ribosomal protein S28-like protein protein, length: 68 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13871
95 % 3 7 13860
90 % 3 7 13662
70 % 111 237 225
50 % 120 251 217
40 % 120 252 222
30 % 120 252 231
Entity #49 | Chains: CU
Faf1 protein, length: 311 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13872
95 % 3 7 13861
90 % 3 7 14202
70 % 3 7 12875
50 % 3 7 11721
40 % 3 7 11007
30 % 3 7 10156
Entity #5 | Chains: UF
Utp6 protein, length: 414 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 14881
95 % 3 7 14675
90 % 3 7 14187
70 % 3 7 13336
50 % 3 7 12416
40 % 3 7 11644
30 % 3 7 10505
Entity #50 | Chains: C1
35S ribosomal RNA rna, length: 2352 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
Entity #51 | Chains: C2
U3 snoRNA rna, length: 230 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
Entity #52 | Chains: UV
U3 small nucleolar RNA-associated protein 22 protein, length: 1171 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 4 32739
95 % 1 4 27878
90 % 1 4 26898
70 % 1 4 24402
50 % 1 4 21403
40 % 1 4 19576
30 % 1 4 17528
Entity #53 | Chains: CV
Rrp7 protein, length: 322 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 4 25723
95 % 1 4 27485
90 % 1 4 24607
70 % 1 4 22372
50 % 1 4 19757
40 % 1 4 18152
30 % 1 4 16287
Entity #54 | Chains: CW
Ribosome biogenesis protein ENP2 protein, length: 668 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 4 28994
95 % 2 4 22483
90 % 2 4 21872
70 % 2 4 21962
50 % 2 4 19423
40 % 2 4 16461
30 % 2 4 16030
Entity #55 | Chains: UT
Utp20 protein, length: 2612 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 4 30776
95 % 2 4 23071
90 % 2 4 24126
70 % 2 4 21963
50 % 2 4 17850
40 % 2 4 17856
30 % 2 4 16031
Entity #56 | Chains: UH
Utp8 protein, length: 930 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 6 17279
95 % 3 6 18343
90 % 3 6 17982
70 % 3 6 16621
50 % 3 6 14959
40 % 3 6 13881
30 % 3 6 12633
Entity #57 | Chains: UE,UI
Utp5 protein, length: 410 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 6 7425
95 % 3 6 8039
90 % 3 6 8033
70 % 3 6 7446
50 % 3 6 7386
40 % 3 6 7118
30 % 3 6 6719
Entity #58 | Chains: US
Noc4 protein, length: 549 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 6 19554
95 % 3 6 16854
90 % 3 6 17874
70 % 3 6 16525
50 % 3 6 14873
40 % 3 6 13807
30 % 3 6 12564
Entity #59 | Chains: Cl
Rps18 protein, length: 156 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 6 17885
95 % 3 6 15691
90 % 3 6 15430
70 % 107 224 236
50 % 109 233 237
40 % 116 246 227
30 % 116 246 235
Entity #6 | Chains: UG
Utp7 protein, length: 558 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 14195
95 % 3 7 14547
90 % 3 7 14342
70 % 3 7 13488
50 % 3 7 12300
40 % 15 21 4090
30 % 15 21 3986
Entity #60 | Chains: CX
Enp1 protein, length: 480 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 6 17348
95 % 3 6 15315
90 % 3 6 14599
70 % 3 6 13731
50 % 3 6 12522
40 % 3 6 11742
30 % 18 29 2905
Entity #61 | Chains: CY
U3 small nucleolar ribonucleoprotein protein lcp5-like protein protein, length: 381 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 3 37318
95 % 2 3 29296
90 % 2 3 28204
70 % 2 3 25511
50 % 2 3 22323
40 % 2 3 20400
30 % 2 3 18266
Entity #62 | Chains: CZ
Bfr2 protein, length: 609 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 4 27728
95 % 2 4 20677
90 % 2 4 20187
70 % 2 4 18635
50 % 2 4 16694
40 % 2 4 15481
30 % 2 4 14035
Entity #63 | Chains: UP
Utp16 protein, length: 364 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 6 18523
95 % 3 6 16924
90 % 3 6 16392
70 % 3 6 15475
50 % 3 6 13972
40 % 3 6 12883
30 % 3 6 11768
Entity #7 | Chains: UJ
UTP10 protein, length: 1802 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 8 12514
95 % 3 8 11658
90 % 3 8 11529
70 % 3 8 11053
50 % 3 8 10236
40 % 3 8 9740
30 % 3 8 9002
Entity #8 | Chains: UK
U3 small nucleolar RNA-associated protein 11 protein, length: 270 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 14196
95 % 3 7 14548
90 % 3 7 14343
70 % 3 7 13489
50 % 3 7 12301
40 % 3 7 11543
30 % 3 7 10623
Entity #9 | Chains: UL
Utp12 protein, length: 962 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 14853
95 % 3 7 14624
90 % 3 7 14422
70 % 3 7 13568
50 % 3 7 12378
40 % 17 25 3325
30 % 17 25 3321

Instructions

In the table for each entity, view a list of similar sequences by selecting the link associated with the percentage cutoff.



View more detailed documentation on the redundancy reduction and sequence clustering procedure used by RCSB PDB.

You can also use the structure comparison tool to compare any 2 given structures


ACTION - (A) Select for download / view details OR (B) Select two chains for comparison
Rank PDB ID Entity ID Chains Description Details Taxonomy EC Number
1 4V88 13 AL, CL 40S ribosomal protein S11-A 4932
2 4U4R 13 C1, c1 40S ribosomal protein S11-A 4932
3 4U3U 13 C1, c1 40S ribosomal protein S11-A 4932
4 5TBW 60 M, c1 40S ribosomal protein S11-A 4932
5 4U3M 13 C1, c1 40S ribosomal protein S11-A 4932
6 4U3N 13 C1, c1 40S ribosomal protein S11-A 4932
7 4U52 13 C1, c1 40S ribosomal protein S11-A 4932
8 4U4Q 13 C1, c1 40S ribosomal protein S11-A 4932
9 4U6F 13 C1, c1 40S ribosomal protein S11-A 4932
10 4U4U 13 C1, c1 40S ribosomal protein S11-A 4932
11 4U4Z 13 C1, c1 40S ribosomal protein S11-A 4932
12 4U4Y 13 C1, c1 40S ribosomal protein S11-A 4932
13 4U4N 13 C1, c1 40S ribosomal protein S11-A 4932
14 4U55 13 C1, c1 40S ribosomal protein S11-A 4932
15 5DAT 13 C1, c1 40S ribosomal protein S11-A 4932
16 5I4L 13 C1, c1 40S ribosomal protein S11-A 4932
17 4U51 13 C1, c1 40S ribosomal protein S11-A 4932
18 6HHQ 59 M, c1 40S ribosomal protein S11-A 4932
19 5OBM 57 C1, c1 40S ribosomal protein S11-A 4932
20 4U53 13 C1, c1 40S ribosomal protein S11-A 4932
21 5ON6 61 M, c1 40S ribosomal protein S11-A 4932
22 4U50 13 C1, c1 40S ribosomal protein S11-A 4932
23 5NDV 57 C1, c1 40S ribosomal protein S11-A 4932
24 5LYB 13 C1, c1 40S ribosomal protein S11-A,40S ribosomal protein S11-A,40S Ribosomal Protein S11-A 4932
25 4U56 13 C1, c1 40S ribosomal protein S11-A 4932
26 5TGA 13 C1, c1 40S ribosomal protein S11-A 4932
27 5MEI 60 M, c1 40S ribosomal protein S11-A 4932
28 5FCJ 13 C1, c1 40S ribosomal protein S11-A,40S ribosomal protein S11-A,40S ribosomal protein S11-A,40S ribosomal protein S11-A,40S ribosomal protein S11-A (uS17) (UNK) residues correspond to residues that aren't well resolved, and for which side-chains could not be modeled. (UNK)s were substituted in the original sequence of the crystallized protein. Remaining misalignments result from differences in the distribution of (UNK)s between the two instances of the molecule in the structure. Here is the original sequence ot the crystallized protein : STELTVQSERAFQKQPHIFNNPKVKTSKRTKRWYKNAGLGFKTPKTAIEGSYIDKKCPFTGLVSIRGKILTGTVVSTKMH RTIVIRRAYLHYIPKYNRYEKRHKNVPVHVSPAFRVQVGDIVTVGQCRPISKTVRFNVVKVSAAAAKANKQFAKF 4932
29 4U4O 13 C1, c1 40S ribosomal protein S11-A 4932
30 5DGV 13 C1, c1 40S ribosomal protein S11-A 4932
31 5DGE 13 C1, c1 40S ribosomal protein S11-A 4932
32 5NDW 6 C1, c1 40S ribosomal protein S11-A 4932
33 4BTS 27 AQ, BQ, CQ, DQ 40S RIBOSOMAL PROTEIN RPS11E 5911
34 5NDG 13 C1, c1 40S ribosomal protein S11-A 4932
35 5FCI 13 C1, c1 40S ribosomal protein S11-A,40S ribosomal protein S11-A (uS17) (UNK) residues correspond to residues that aren't well resolved, and for which side-chains could not be modeled. (UNK)s were substituted in the original sequence of the crystallized protein. Remaining misalignments result from differences in the distribution of (UNK)s between the two instances of the molecule in the structure. Here is the original sequence ot the crystallized protein : STELTVQSERAFQKQPHIFNNPKVKTSKRTKRWYKNAGLGFKTPKTAIEGSYIDKKCPFTGLVSIRGKILTGTVVSTKMH RTIVIRRAYLHYIPKYNRYEKRHKNVPVHVSPAFRVQVGDIVTVGQCRPISKTVRFNVVKVSAAAAKANKQFAKF 4932
36 5DC3 13 C1, c1 40S ribosomal protein S11-A 4932
37 5DGF 13 C1, c1 40S ribosomal protein S11-A 4932
38 4V5O 26 AQ, BQ RIBOSOMAL PROTEIN S17 CONTAINING PROTEIN 5911
39 5TGM 13 C1, c1 40S ribosomal protein S11-A,40S Ribosomal Protein S11 4932
40 4V7R 7 AF, CF 40S ribosomal protein S11 4932
41 5VYC 30 L1, L2, L3, L4, L5, L6 40S ribosomal protein S11 9606
42 4KZZ 12 L 40S Ribosomal Protein S11 9986
43 4KZX 12 L 40S ribosomal protein S11 9986
44 4KZY 12 L 40S Ribosomal Protein S11 9986
45 7K5I 25 L 40S ribosomal protein S11 9606
46 7A1G 10 X 40S ribosomal protein S11-A 4932
47 7A09 11 n 40S ribosomal protein S11 9606
48 6ZVH 10 L 40S ribosomal protein S11 9606
49 6ZVI 16 t 40S ribosomal protein S11-A 4932
50 6ZVJ 11 n 40S ribosomal protein S11 9606
51 6ZU9 10 X 40S ribosomal protein S11-A 4932
52 6ZQB 55 DL 40S ribosomal protein S11-A 4932
53 6ZQC 55 DL 40S ribosomal protein S11-A 4932
54 6ZQD 51 DL 40S ribosomal protein S11-A 4932
55 6ZQE 47 DL 40S ribosomal protein S11-A 4932
56 6ZQF 33 DL 40S ribosomal protein S11-A 4932
57 6ZQG 25 DL 40S ribosomal protein S11-A 4932
58 6ZP4 11 n 40S ribosomal protein S11 9606
59 6ZOJ 13 L 40S ribosomal protein S11 9606
60 6ZOK 10 L 40S ribosomal protein S11 9606
61 6ZON 11 n 40S ribosomal protein S11 9606
62 6ZN5 11 L 40S ribosomal protein S11 9606
63 6ZMW 25 B 40S ribosomal protein S11 9606
64 6ZMO 58 SL 40S ribosomal protein S11 9606
65 6ZMT 11 L 40S ribosomal protein S11 9606
66 6ZME 58 SL 40S ribosomal protein S11 9606
67 6ZMI 58 SL 40S ribosomal protein S11 9606
68 6ZLW 11 L 40S ribosomal protein S11 9606
69 6ZM7 58 SL 40S ribosomal protein S11 9606
70 6ZJ3 26 SU Ribosomal protein uS17 3039
71 6XIQ 27 AB 40S ribosomal protein S11-A 4932
72 6XIR 27 AB 40S ribosomal protein S11-A 4932
73 6ZCE 15 M 40S ribosomal protein S11-A 4932
74 6XA1 55 SL 40S ribosomal protein S11 9606
75 6Z6J 17 SL 40S ribosomal protein S11-A 4932
76 6Z6K 17 SL 40S ribosomal protein S11-A 4932
77 6Z6L 56 SL 40S ribosomal protein S11 9606
78 6Z6M 56 SL 40S ribosomal protein S11 9606
79 6Z6N 56 SL 40S ribosomal protein S11 9606
80 6WOO 59 LL uS17 4932
81 6WDR 11 L 40S ribosomal protein S11-A 4932
82 6YBW 2 B 40S ribosomal protein S11 9606
83 6YAL 14 N 40S ribosomal protein uS17 9986
84 6YAM 14 N 40S ribosomal protein uS17 9986
85 6YAN 13 N Ribosomal protein S11 9986
86 6W2S 11 M uS17 9986
87 6W2T 10 M uS17 9986
88 6Y7C 11 L 40S ribosomal protein S11-A 4932
89 6Y57 61 SL 40S ribosomal protein S11 9606
90 6Y2L 61 SL 40S ribosomal protein S11 9606
91 6Y0G 61 SL 40S ribosomal protein S11 9606
92 6LQP 11 SM 40S ribosomal protein S11-A 4932
93 6LQQ 11 SM 40S ribosomal protein S11-A 4932
94 6LQR 11 SM 40S ribosomal protein S11-A 4932
95 6LQS 11 SM 40S ribosomal protein S11-A 4932
96 6LQT 11 SM 40S ribosomal protein S11-A 4932
97 6LQU 10 SM 40S ribosomal protein S11-A 4932
98 6LQV 9 SM 40S ribosomal protein S11-A 4932
99 6TNU 15 X 40S ribosomal protein S11-A 4932
100 6UZ7 59 L KLLA0A10483p 28985
101 6TB3 15 X 40S ribosomal protein S11-A 4932
102 6T83 14 Lb, m 40S ribosomal protein S11-A 4932
103 6T7T 16 SL 40S ribosomal protein S11-A 4932
104 6T7I 14 SL 40S ribosomal protein S11-A 4932
105 6T4Q 13 SL 40S ribosomal protein S11-A 4932
106 6SV4 30 X, Xb, Xc 40S ribosomal protein S11-A 4932
107 6SNT 14 L 40S ribosomal protein S11-A 4932
108 6SGC 13 M1 Ribosomal protein S11 9986
109 6KE6 11 SM 40S ribosomal protein S11-A 4932
110 6S47 57 BM 40S ribosomal protein S11-A 4932
111 6RXU 44 Ck 40S ribosomal protein S11-like protein 209285
112 6RXV 44 Ck 40S ribosomal protein S11-like protein 209285
113 6RXX 41 Ck 40S ribosomal protein S11-like protein 209285
114 6RXZ 43 Ck 40S ribosomal protein S11-like protein 209285
115 6P5I 13 M uS17 9986
116 6P5J 13 M uS17 9986
117 6P5K 59 M uS17 9986
118 6P5N 59 M uS17 9986
119 6P4G 13 M uS17 9986
120 6P4H 14 M uS17 9986
121 6OM7 10 SL 40S ribosomal protein S11 9606
122 6OLZ 58 BL 40S ribosomal protein S11 9606
123 6OM0 10 SL 40S ribosomal protein S11 9606
124 6OLE 10 SL 40S ribosomal protein S11 9606
125 6OLF 10 SL 40S ribosomal protein S11 9606
126 6OLG 61 BL 40S ribosomal protein S11 9606
127 6OLI 10 SL 40S ribosomal protein S11 9606
128 6OKK 22 V 40S ribosomal protein S11 5833
129 6RBD 12 L 40S ribosomal protein S11-A 4932
130 6RBE 10 L 40S ribosomal protein S11-A 4932
131 6R7Q 5 EE Ribosomal protein S11 9986
132 6R6G 19 EE Ribosomal protein S11 9986
133 6R6P 60 EE Ribosomal protein S11 9986
134 6R5Q 63 EE Ribosomal protein S11 9986
135 6QZP 57 SL 40S ribosomal protein S11 9606
136 6Q8Y 79 X 40S ribosomal protein S11-A 4932
137 6I7O 30 X, Xb 40S ribosomal protein S11-A 4932
138 6IP5 56 2v 40S ribosomal protein S11 9606
139 6IP6 55 2v 40S ribosomal protein S11 9606
140 6IP8 55 2v 40S ribosomal protein S11 9606
141 6MTB 62 LL 40S ribosomal protein S11 9986
142 6MTC 61 LL 40S ribosomal protein S11 9986
143 6MTD 63 LL uS17 9986
144 6MTE 62 LL uS17 9986
145 6HCQ 16 M2 Ribosomal protein S11 9986
146 6HCJ 16 M2 Ribosomal protein S11 9986
147 6HCM 13 M1 Ribosomal protein S11 9986
148 6HCF 13 M1 Ribosomal protein S11 9986
149 6GZ3 29 BL Ribosomal protein S11 9986
150 6GZ4 32 BL ribosomal protein uS17 9986
151 6GZ5 29 BL ribosomal protein uS17 9986
152 6GSM 15 L KLLA0A10483p 28985
153 6GSN 36 L KLLA0A10483p 28985
154 6GQV 59 AB 40S ribosomal protein S11-A 4932
155 6GQ1 59 AB 40S ribosomal protein S11-A 4932
156 6GQB 59 AB 40S ribosomal protein S11-A 4932
157 6D9J 61 MM uS17 9986
158 6D90 62 MM uS17 9986
159 6G5H 10 L 40S ribosomal protein S11 9606
160 6G5I 13 L 40S ribosomal protein S11 9606
161 6G4S 29 L 40S ribosomal protein S11 9606
162 6G4W 25 L 40S ribosomal protein S11 9606
163 6G51 11 L 40S ribosomal protein S11 9606
164 6G53 11 L 40S ribosomal protein S11 9606
165 6G18 21 L 40S ribosomal protein S11 9606
166 6FYX 15 L KLLA0A10483p 28985
167 6FYY 15 L KLLA0A10483p 28985
168 6FEC 12 G 40S ribosomal protein S11 9606
169 6FAI 22 L 40S ribosomal protein S11-A 4932
170 6EML 20 X 40S ribosomal protein S11-A 4932
171 6EK0 57 SL 40S ribosomal protein S11 9606
172 6AZ1 21 U ribosomal protein S17 5661
173 5OQL 44 v 40S ribosomal protein S11-like protein 209285
174 5OPT 16 X 40S ribosomal protein S11, putative 5693
175 5WLC 12 LD rpS11_uS17 4932
176 5XYI 13 L Uncharacterized protein 5722
177 5XXU 13 L Ribosomal protein uS17 5811
178 5OA3 16 L 40S ribosomal protein S11 9606
179 5WYJ 42 SM 40S ribosomal protein S11-A 4932
180 5WYK 39 SM 40S ribosomal protein S11-A 4932
181 5TZS 13 D rpS11_uS17 4932
182 5MC6 25 X 40S ribosomal protein S11-A 4932
183 5M1J 19 L2 40S ribosomal protein S11-A 4932
184 5LZS 62 LL uS17 9986
185 5LZT 63 LL uS17 9986
186 5LZU 62 LL uS17 9986
187 5LZV 63 LL uS17 9986
188 5LZW 63 LL uS17 9986
189 5LZX 63 LL uS17 9986
190 5LZY 61 LL uS17 9986
191 5LZZ 63 LL uS17 9986
192 5T2A 61 AE uS17 5661
193 5T2C 73 Aw 40S ribosomal protein S11 9606
194 5LL6 10 X 40S ribosomal protein S11-A 4932
195 5LKS 56 SL 40S ribosomal protein S11 9606
196 5K0Y 5 G ribosomal protein uS17 9986
197 5JUO 61 IB uS17 (yeast S11) 4932
198 5JUP 61 IB uS17 (yeast S11) 4932
199 5JUS 61 IB uS17 (yeast S11) 4932
200 5JUT 61 IB uS17 (yeast S11) 4932
201 5JUU 61 IB uS17 (yeast S11) 4932
202 5JPQ 31 y uS17 209285
203 5IT7 59 L KLLA0A10483p 28985
204 5IT9 12 L Ribosomal protein uS17 28985
205 5FLX 13 L 40S RIBOSOMAL PROTEIN S11 9986
206 3JBN 31 V 40S ribosomal protein uS17 5833
207 3JBO 8 V 40S ribosomal protein uS17 5833
208 3JBP 31 V 40S ribosomal protein uS17 5833
209 3JAP 15 L uS17 28985
210 3JAQ 15 L uS17 28985
211 3JAM 13 L uS17 28985
212 3JAN 62 SL Ribosomal protein uS17 SEE REMARK 999 9986
213 3JAJ 63 SL Ribosomal protein uS17 SEE REMARK 999 9986
214 3JAG 63 LL uS17 9986
215 3JAH 63 LL uS17 9986
216 3JAI 63 LL uS17 9986
217 5A2Q 14 L RIBOSOMAL PROTEIN US17 9606
218 4UG0 57 SL 40S RIBOSOMAL PROTEIN S11 9606
219 5AJ0 61 BL 40S ribosomal protein S11 9606
220 4UER 27 Q US17 4934
221 4D61 13 L 40S RIBOSOMAL PROTEIN S11 9986
222 4D5L 13 L 40S RIBOSOMAL PROTEIN US17 9986
223 3J81 13 L uS17 28985
224 3J80 10 L uS17 28985
225 3J7P 61 SL Ribosomal protein uS17 9823
226 3J7R 62 SL Ribosomal protein uS17 9823
227 4UJC 62 CL 40S RIBOSOMAL PROTEIN US17 9986
228 4UJD 62 CL 40S RIBOSOMAL PROTEIN US17 9986
229 3J7A 22 V 40S ribosomal protein uS17 5833
230 3J77 57 11 40S ribosomal protein S11 4932
231 3J78 57 11 40S ribosomal protein S11 4932
232 3J6X 58 11 40S ribosomal protein S11 4932
233 3J6Y 58 11 40S ribosomal protein S11 4932
234 4UJE 16 BL 40S RIBOSOMAL PROTEIN S11 9986
235 4V92 14 BL US17 28985
236 4V7E 19 BL 40S ribosomal protein S17 4565
237 4V8Y 20 AL 40S RIBOSOMAL PROTEIN S11-A 4932
238 4V8Z 20 AL 40S RIBOSOMAL PROTEIN S11-A 4932
239 4V6W 11 AL 40S ribosomal protein S11 7227
240 4V6X 11 AL 40S ribosomal protein S11 9606
241 4V8M 13 AE 40S RIBOSOMAL PROTEINS S11, PUTATIVE 185431
242 4V6I 18 AP 40S ribosomal protein rpS11 (S17p) 4932
243 4V5Z 23 Aq 40S Ribosomal protein S11e 9612