Cryo-EM structure of the 90S pre-ribosome (Kre33-Noc4) from Chaetomium thermophilum, state B2

Sequence Similarity Clusters for the Entities in PDB 6RXV

Entity #1 | Chains: UA
Periodic tryptophan protein 2-like protein protein, length: 904 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 14249
95 % 3 7 13651
90 % 3 7 13466
70 % 3 7 12689
50 % 17 25 3310
40 % 17 25 3282
30 % 17 25 3247
Entity #10 | Chains: UM
Utp13 protein, length: 912 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 14453
95 % 3 7 14067
90 % 3 7 14274
70 % 3 7 13067
50 % 3 7 11893
40 % 3 7 11157
30 % 3 7 10302
Entity #11 | Chains: UN
Utp14 protein, length: 938 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13650
95 % 3 7 13681
90 % 3 7 13494
70 % 3 7 12487
50 % 3 7 11592
40 % 3 7 10680
30 % 3 7 9873
Entity #12 | Chains: UO
Utp15 protein, length: 557 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 14447
95 % 3 7 13968
90 % 3 7 13857
70 % 3 7 13051
50 % 3 7 12001
40 % 3 7 11144
30 % 16 22 3640
Entity #13 | Chains: UQ
Utp17 protein, length: 960 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13527
95 % 3 7 13413
90 % 3 7 13495
70 % 3 7 12708
50 % 3 7 11383
40 % 3 7 10882
30 % 3 7 9874
Entity #14 | Chains: UR
Utp18 protein, length: 618 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 14114
95 % 3 7 13397
90 % 3 7 13214
70 % 3 7 12467
50 % 3 7 11369
40 % 3 7 10669
30 % 16 24 3364
Entity #15 | Chains: UU
Utp21 protein, length: 1049 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13944
95 % 3 7 14254
90 % 3 7 14040
70 % 3 7 13216
50 % 3 7 12066
40 % 3 7 11300
30 % 3 7 10428
Entity #16 | Chains: UX
Utp24 protein, length: 193 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 8 13071
95 % 3 8 12396
90 % 3 8 12230
70 % 3 8 11626
50 % 17 26 3270
40 % 17 26 3241
30 % 17 26 3216
Entity #17 | Chains: UZ
Utp30 protein, length: 391 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13760
95 % 3 7 14255
90 % 3 7 14041
70 % 3 7 13217
50 % 3 7 12067
40 % 3 7 11301
30 % 3 7 10429
Entity #18 | Chains: CA,CB
Nop1 protein, length: 313 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 5664
95 % 3 7 6291
90 % 3 7 6324
70 % 3 7 6275
50 % 16 24 1632
40 % 16 24 1672
30 % 16 24 1700
Entity #19 | Chains: CC
Nop56 protein, length: 523 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13759
95 % 3 7 13904
90 % 3 7 13727
70 % 3 7 13215
50 % 16 24 3610
40 % 29 41 1984
30 % 29 41 1995
Entity #2 | Chains: UB
Utp2 protein, length: 907 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 14265
95 % 3 7 14287
90 % 3 7 13504
70 % 3 7 12713
50 % 3 7 11602
40 % 3 7 11329
30 % 3 7 10455
Entity #20 | Chains: CD
Nop58 protein, length: 582 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 14659
95 % 3 7 14466
90 % 3 7 14255
70 % 3 7 13413
50 % 3 7 12311
40 % 3 7 11479
30 % 3 7 10572
Entity #21 | Chains: CE,CF
Snu13 protein, length: 127 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 5818
95 % 3 7 6592
90 % 3 7 6631
70 % 3 7 6550
50 % 25 47 947
40 % 26 48 958
30 % 25 47 1028
Entity #22 | Chains: CG
Rrp9 protein, length: 630 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 14487
95 % 3 7 14137
90 % 3 7 13941
70 % 3 7 12988
50 % 3 7 11970
40 % 3 7 11097
30 % 3 7 10240
Entity #23 | Chains: CH
RNA 3'-terminal phosphate cyclase-like protein protein, length: 411 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13693
95 % 3 7 13782
90 % 3 7 13599
70 % 3 7 12808
50 % 3 7 11678
40 % 3 7 10948
30 % 3 7 10109
Entity #24 | Chains: CI
Bms1 protein, length: 1163 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 14411
95 % 3 7 13987
90 % 3 7 13802
70 % 3 7 12989
50 % 3 7 11843
40 % 18 26 3248
30 % 18 26 3222
Entity #25 | Chains: CJ
Imp3 protein, length: 183 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 8 11716
95 % 3 8 11116
90 % 3 8 12803
70 % 3 8 10575
50 % 17 26 3160
40 % 17 26 3140
30 % 17 26 3114
Entity #26 | Chains: CK
Imp4 protein, length: 297 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 8 11028
95 % 3 8 11844
90 % 3 8 11422
70 % 3 8 11163
50 % 18 26 3269
40 % 18 26 3240
30 % 18 26 3215
Entity #27 | Chains: CL
Mpp10 protein, length: 785 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13755
95 % 3 7 14390
90 % 3 7 13721
70 % 3 7 12907
50 % 3 7 11774
40 % 3 7 11032
30 % 3 7 10185
Entity #28 | Chains: CM
Sof1 protein, length: 446 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 14658
95 % 3 7 13758
90 % 3 7 13575
70 % 3 7 12784
50 % 3 7 12244
40 % 15 21 4037
30 % 15 21 3888
Entity #29 | Chains: CN,CO
Emg1 protein, length: 252 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 5776
95 % 3 7 6337
90 % 3 7 6377
70 % 23 32 1242
50 % 23 32 1278
40 % 23 32 1320
30 % 23 32 1360
Entity #3 | Chains: UC
Utp3 protein, length: 648 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 14007
95 % 3 7 14381
90 % 3 7 14165
70 % 3 7 13323
50 % 3 7 12163
40 % 3 7 11406
30 % 18 23 3595
Entity #30 | Chains: CP
KRR1 small subunit processome component protein, length: 322 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 8 9511
95 % 3 8 10341
90 % 3 8 10250
70 % 10 18 4648
50 % 10 18 4436
40 % 10 18 4359
30 % 10 18 4265
Entity #31 | Chains: CQ
Pre-rRNA-processing protein PNO1 protein, length: 259 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13517
95 % 3 7 13358
90 % 3 7 13213
70 % 3 7 12466
50 % 3 7 11341
40 % 3 7 10668
30 % 3 7 9838
Entity #32 | Chains: CR,CS
Kre33 protein, length: 1073 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 8 4427
95 % 3 8 5290
90 % 3 8 5358
70 % 3 8 5340
50 % 11 16 2618
40 % 11 16 2616
30 % 11 16 2606
Entity #33 | Chains: CT
Fcf2 protein, length: 203 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 14231
95 % 3 7 13610
90 % 3 7 13425
70 % 3 7 12652
50 % 3 7 11543
40 % 3 7 10828
30 % 3 7 10000
Entity #34 | Chains: Ca
40S ribosomal protein S1 protein, length: 255 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 5 19332
95 % 3 5 18094
90 % 3 5 17740
70 % 70 110 424
50 % 72 116 440
40 % 101 197 293
30 % 101 197 307
Entity #35 | Chains: Cb
40S ribosomal protein S4 protein, length: 264 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 5 21475
95 % 2 5 19131
90 % 2 5 18710
70 % 100 218 239
50 % 102 228 235
40 % 102 232 236
30 % 109 244 227
Entity #36 | Chains: Cc
40S ribosomal protein s5-like protein protein, length: 212 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 14230
95 % 3 7 13609
90 % 3 7 13424
70 % 33 118 535
50 % 105 239 219
40 % 105 239 225
30 % 105 239 233
Entity #37 | Chains: Cd
40S ribosomal protein S6 protein, length: 239 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 5 19331
95 % 2 5 18093
90 % 2 5 17739
70 % 32 108 578
50 % 101 219 252
40 % 101 224 250
30 % 101 224 258
Entity #38 | Chains: Ce
40S ribosomal protein S7 protein, length: 203 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 14271
95 % 3 7 13697
90 % 3 7 13517
70 % 3 7 12729
50 % 102 226 243
40 % 102 226 245
30 % 104 229 246
Entity #39 | Chains: Cf
40S ribosomal protein S8 protein, length: 202 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 5 21345
95 % 2 5 19347
90 % 2 5 18899
70 % 70 113 413
50 % 102 227 236
40 % 102 231 237
30 % 102 231 244
Entity #4 | Chains: UD
Utp4 protein, length: 884 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 4 8 10385
95 % 4 8 10853
90 % 4 8 10762
70 % 4 8 10357
50 % 4 8 9628
40 % 4 8 9184
30 % 4 8 8568
Entity #40 | Chains: Cg
40S ribosomal protein s9-like protein protein, length: 190 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 14270
95 % 3 7 13696
90 % 3 7 13516
70 % 103 223 234
50 % 105 238 223
40 % 112 249 217
30 % 112 249 223
Entity #41 | Chains: Ch
40S ribosomal protein S13-like protein protein, length: 151 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 14311
95 % 3 7 13770
90 % 3 7 13587
70 % 103 232 227
50 % 105 235 231
40 % 112 247 218
30 % 112 247 224
Entity #42 | Chains: Ci
40S ribosomal protein S14-like protein protein, length: 150 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 14363
95 % 3 7 13873
90 % 33 99 650
70 % 105 236 218
50 % 105 237 226
40 % 105 237 228
30 % 105 237 235
Entity #43 | Chains: Cj
40S ribosomal protein S16-like protein protein, length: 143 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 14272
95 % 3 7 13698
90 % 3 7 13518
70 % 3 7 12730
50 % 103 228 234
40 % 110 239 227
30 % 110 240 230
Entity #44 | Chains: Ck
40S ribosomal protein S11-like protein protein, length: 161 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 5 20197
95 % 2 5 19499
90 % 2 5 19174
70 % 71 115 396
50 % 103 234 232
40 % 103 234 233
30 % 103 234 241
Entity #45 | Chains: Cm
40S ribosomal protein S22-like protein protein, length: 130 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13866
95 % 3 7 14090
90 % 3 7 13897
70 % 103 238 220
50 % 105 240 222
40 % 113 252 213
30 % 552 896 20
Entity #46 | Chains: Cn
40S ribosomal protein s23-like protein protein, length: 145 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 14338
95 % 3 7 13680
90 % 3 7 13492
70 % 105 242 211
50 % 112 255 204
40 % 112 255 210
30 % 112 255 220
Entity #47 | Chains: Co
40S ribosomal protein S24 protein, length: 136 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 5 20269
95 % 2 5 19500
90 % 2 5 19059
70 % 70 115 401
50 % 100 229 238
40 % 100 229 240
30 % 100 229 250
Entity #48 | Chains: Cp
40S ribosomal protein S28-like protein protein, length: 68 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 14364
95 % 3 7 14207
90 % 3 7 13691
70 % 103 229 229
50 % 112 243 214
40 % 112 244 219
30 % 112 244 226
Entity #49 | Chains: CU
Faf1 protein, length: 311 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 14643
95 % 3 7 14447
90 % 3 7 14230
70 % 3 7 13388
50 % 3 7 12218
40 % 3 7 11454
30 % 3 7 10553
Entity #5 | Chains: UF
Utp6 protein, length: 414 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 14142
95 % 3 7 13458
90 % 3 7 13277
70 % 3 7 12525
50 % 3 7 11416
40 % 3 7 10712
30 % 3 7 9904
Entity #50 | Chains: C1
35S ribosomal RNA rna, length: 2352 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
Entity #51 | Chains: C2
U3 snoRNA rna, length: 230 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
Entity #52 | Chains: UV
U3 small nucleolar RNA-associated protein 22 protein, length: 1171 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 4 27179
95 % 1 4 27505
90 % 1 4 26569
70 % 1 4 24132
50 % 1 4 21166
40 % 1 4 19359
30 % 1 4 17345
Entity #53 | Chains: CV
Rrp7 protein, length: 322 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 4 29340
95 % 1 4 23223
90 % 1 4 22609
70 % 1 4 23610
50 % 1 4 20752
40 % 1 4 16849
30 % 1 4 15223
Entity #54 | Chains: CW
Ribosome biogenesis protein ENP2 protein, length: 668 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 4 32214
95 % 2 4 25089
90 % 2 4 24324
70 % 2 4 22143
50 % 2 4 19529
40 % 2 4 17904
30 % 2 4 17163
Entity #55 | Chains: UT
Utp20 protein, length: 2612 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 4 30336
95 % 2 4 24149
90 % 2 4 23883
70 % 2 4 21751
50 % 2 4 18935
40 % 2 4 17614
30 % 2 4 15894
Entity #56 | Chains: UH
Utp8 protein, length: 930 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 6 16982
95 % 3 6 18063
90 % 3 6 17708
70 % 3 6 16302
50 % 3 6 14781
40 % 3 6 13711
30 % 3 6 12495
Entity #57 | Chains: UE,UI
Utp5 protein, length: 410 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 6 7768
95 % 3 6 8365
90 % 3 6 8337
70 % 3 6 8115
50 % 3 6 7455
40 % 3 6 7350
30 % 3 6 6910
Entity #58 | Chains: US
Noc4 protein, length: 549 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 6 18374
95 % 3 6 15811
90 % 3 6 16362
70 % 3 6 15258
50 % 3 6 13230
40 % 3 6 12856
30 % 3 6 11157
Entity #59 | Chains: Cl
Rps18 protein, length: 156 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 6 18112
95 % 3 6 16536
90 % 3 6 16225
70 % 98 215 241
50 % 100 224 239
40 % 107 236 230
30 % 107 237 237
Entity #6 | Chains: UG
Utp7 protein, length: 558 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 14266
95 % 3 7 13689
90 % 3 7 13505
70 % 3 7 12714
50 % 3 7 11603
40 % 15 21 4019
30 % 15 21 3932
Entity #60 | Chains: CX
Enp1 protein, length: 480 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 6 17051
95 % 3 6 14627
90 % 3 6 14417
70 % 3 6 13569
50 % 3 6 12389
40 % 3 6 11610
30 % 18 29 2808
Entity #61 | Chains: CY
U3 small nucleolar ribonucleoprotein protein lcp5-like protein protein, length: 381 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 3 36066
95 % 2 3 28364
90 % 2 3 26741
70 % 2 3 24273
50 % 2 3 21300
40 % 2 3 19472
30 % 2 3 17454
Entity #62 | Chains: CZ
Bfr2 protein, length: 609 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 4 30337
95 % 2 4 25334
90 % 2 4 24559
70 % 2 4 21752
50 % 2 4 19215
40 % 2 4 17615
30 % 2 4 15895
Entity #63 | Chains: UP
Utp16 protein, length: 364 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 6 16728
95 % 3 6 17709
90 % 3 6 15936
70 % 3 6 16113
50 % 3 6 14515
40 % 3 6 13490
30 % 3 6 12304
Entity #7 | Chains: UJ
UTP10 protein, length: 1802 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 8 13427
95 % 3 8 13232
90 % 3 8 12494
70 % 3 8 12327
50 % 3 8 11243
40 % 3 8 10564
30 % 3 8 9768
Entity #8 | Chains: UK
U3 small nucleolar RNA-associated protein 11 protein, length: 270 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 14008
95 % 3 7 14382
90 % 3 7 14166
70 % 3 7 13324
50 % 3 7 12164
40 % 3 7 11407
30 % 3 7 10515
Entity #9 | Chains: UL
Utp12 protein, length: 962 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 14687
95 % 3 7 14503
90 % 3 7 14300
70 % 3 7 13445
50 % 3 7 12278
40 % 17 25 3302
30 % 17 25 3237


In the table for each entity, view a list of similar sequences by selecting the link associated with the percentage cutoff.

View more detailed documentation on the redundancy reduction and sequence clustering procedure used by RCSB PDB.

You can also use the structure comparison tool to compare any 2 given structures

ACTION - (A) Select for download / view details OR (B) Select two chains for comparison
Rank PDB ID Entity ID Chains Description Details Taxonomy EC Number
1 4V88 13 AL, CL 40S ribosomal protein S11-A 4932
2 4U4R 13 C1, c1 40S ribosomal protein S11-A 4932
3 4U3U 13 C1, c1 40S ribosomal protein S11-A 4932
4 5TBW 60 M, c1 40S ribosomal protein S11-A 4932
5 4U3M 13 C1, c1 40S ribosomal protein S11-A 4932
6 4U3N 13 C1, c1 40S ribosomal protein S11-A 4932
7 4U52 13 C1, c1 40S ribosomal protein S11-A 4932
8 4U4Q 13 C1, c1 40S ribosomal protein S11-A 4932
9 4U6F 13 C1, c1 40S ribosomal protein S11-A 4932
10 4U4U 13 C1, c1 40S ribosomal protein S11-A 4932
11 4U4Z 13 C1, c1 40S ribosomal protein S11-A 4932
12 4U4Y 13 C1, c1 40S ribosomal protein S11-A 4932
13 4U4N 13 C1, c1 40S ribosomal protein S11-A 4932
14 4U55 13 C1, c1 40S ribosomal protein S11-A 4932
15 5DAT 13 C1, c1 40S ribosomal protein S11-A 4932
16 5I4L 13 C1, c1 40S ribosomal protein S11-A 4932
17 4U51 13 C1, c1 40S ribosomal protein S11-A 4932
18 6HHQ 59 M, c1 40S ribosomal protein S11-A 4932
19 5OBM 57 C1, c1 40S ribosomal protein S11-A 4932
20 4U53 13 C1, c1 40S ribosomal protein S11-A 4932
21 5ON6 61 M, c1 40S ribosomal protein S11-A 4932
22 4U50 13 C1, c1 40S ribosomal protein S11-A 4932
23 5NDV 57 C1, c1 40S ribosomal protein S11-A 4932
24 5LYB 13 C1, c1 40S ribosomal protein S11-A,40S ribosomal protein S11-A,40S Ribosomal Protein S11-A 4932
25 4U56 13 C1, c1 40S ribosomal protein S11-A 4932
26 5TGA 13 C1, c1 40S ribosomal protein S11-A 4932
27 5MEI 60 M, c1 40S ribosomal protein S11-A 4932
28 5FCJ 13 C1, c1 40S ribosomal protein S11-A,40S ribosomal protein S11-A,40S ribosomal protein S11-A,40S ribosomal protein S11-A,40S ribosomal protein S11-A (uS17) (UNK) residues correspond to residues that aren't well resolved, and for which side-chains could not be modeled. (UNK)s were substituted in the original sequence of the crystallized protein. Remaining misalignments result from differences in the distribution of (UNK)s between the two instances of the molecule in the structure. Here is the original sequence ot the crystallized protein : STELTVQSERAFQKQPHIFNNPKVKTSKRTKRWYKNAGLGFKTPKTAIEGSYIDKKCPFTGLVSIRGKILTGTVVSTKMH RTIVIRRAYLHYIPKYNRYEKRHKNVPVHVSPAFRVQVGDIVTVGQCRPISKTVRFNVVKVSAAAAKANKQFAKF 4932
29 4U4O 13 C1, c1 40S ribosomal protein S11-A 4932
30 5DGV 13 C1, c1 40S ribosomal protein S11-A 4932
31 5DGE 13 C1, c1 40S ribosomal protein S11-A 4932
32 5NDW 6 C1, c1 40S ribosomal protein S11-A 4932
33 5NDG 13 C1, c1 40S ribosomal protein S11-A 4932
34 5FCI 13 C1, c1 40S ribosomal protein S11-A,40S ribosomal protein S11-A (uS17) (UNK) residues correspond to residues that aren't well resolved, and for which side-chains could not be modeled. (UNK)s were substituted in the original sequence of the crystallized protein. Remaining misalignments result from differences in the distribution of (UNK)s between the two instances of the molecule in the structure. Here is the original sequence ot the crystallized protein : STELTVQSERAFQKQPHIFNNPKVKTSKRTKRWYKNAGLGFKTPKTAIEGSYIDKKCPFTGLVSIRGKILTGTVVSTKMH RTIVIRRAYLHYIPKYNRYEKRHKNVPVHVSPAFRVQVGDIVTVGQCRPISKTVRFNVVKVSAAAAKANKQFAKF 4932
35 5DC3 13 C1, c1 40S ribosomal protein S11-A 4932
36 5DGF 13 C1, c1 40S ribosomal protein S11-A 4932
37 5TGM 13 C1, c1 40S ribosomal protein S11-A,40S Ribosomal Protein S11 4932
38 4V7R 7 AF, CF 40S ribosomal protein S11 4932
39 6ZVI 16 t 40S ribosomal protein S11-A 4932
40 6ZQB 55 DL 40S ribosomal protein S11-A 4932
41 6ZQC 55 DL 40S ribosomal protein S11-A 4932
42 6ZQD 51 DL 40S ribosomal protein S11-A 4932
43 6ZQE 47 DL 40S ribosomal protein S11-A 4932
44 6ZQF 33 DL 40S ribosomal protein S11-A 4932
45 6ZQG 25 DL 40S ribosomal protein S11-A 4932
46 6XIQ 27 AB 40S ribosomal protein S11-A 4932
47 6XIR 27 AB 40S ribosomal protein S11-A 4932
48 6Z6J 17 SL 40S ribosomal protein S11-A 4932
49 6Z6K 17 SL 40S ribosomal protein S11-A 4932
50 6WOO 59 LL uS17 4932
51 6Y7C 11 L 40S ribosomal protein S11-A 4932
52 6LQP 11 SM 40S ribosomal protein S11-A 4932
53 6LQQ 11 SM 40S ribosomal protein S11-A 4932
54 6LQR 11 SM 40S ribosomal protein S11-A 4932
55 6LQS 11 SM 40S ribosomal protein S11-A 4932
56 6LQT 11 SM 40S ribosomal protein S11-A 4932
57 6LQU 10 SM 40S ribosomal protein S11-A 4932
58 6LQV 9 SM 40S ribosomal protein S11-A 4932
59 6TNU 15 X 40S ribosomal protein S11-A 4932
60 6UZ7 59 L KLLA0A10483p 28985
61 6TB3 15 X 40S ribosomal protein S11-A 4932
62 6T83 14 Lb, m 40S ribosomal protein S11-A 4932
63 6T7T 16 SL 40S ribosomal protein S11-A 4932
64 6T7I 14 SL 40S ribosomal protein S11-A 4932
65 6T4Q 13 SL 40S ribosomal protein S11-A 4932
66 6SV4 30 X, Xb, Xc 40S ribosomal protein S11-A 4932
67 6SNT 14 L 40S ribosomal protein S11-A 4932
68 6KE6 11 SM 40S ribosomal protein S11-A 4932
69 6S47 57 BM 40S ribosomal protein S11-A 4932
70 6RXU 44 Ck 40S ribosomal protein S11-like protein 209285
71 6RXV 44 Ck 40S ribosomal protein S11-like protein 209285
72 6RXX 41 Ck 40S ribosomal protein S11-like protein 209285
73 6RXZ 43 Ck 40S ribosomal protein S11-like protein 209285
74 6RBD 12 L 40S ribosomal protein S11-A 4932
75 6RBE 10 L 40S ribosomal protein S11-A 4932
76 6Q8Y 79 X 40S ribosomal protein S11-A 4932
77 6I7O 30 X, Xb 40S ribosomal protein S11-A 4932
78 6GSM 15 L KLLA0A10483p 28985
79 6GSN 36 L KLLA0A10483p 28985
80 6GQV 59 AB 40S ribosomal protein S11-A 4932
81 6GQ1 59 AB 40S ribosomal protein S11-A 4932
82 6GQB 59 AB 40S ribosomal protein S11-A 4932
83 6FYX 15 L KLLA0A10483p 28985
84 6FYY 15 L KLLA0A10483p 28985
85 6FAI 22 L 40S ribosomal protein S11-A 4932
86 6EML 20 X 40S ribosomal protein S11-A 4932
87 5OQL 44 v 40S ribosomal protein S11-like protein 209285
88 5WLC 12 LD rpS11_uS17 4932
89 5WYJ 42 SM 40S ribosomal protein S11-A 4932
90 5WYK 39 SM 40S ribosomal protein S11-A 4932
91 5TZS 13 D rpS11_uS17 4932
92 5MC6 25 X 40S ribosomal protein S11-A 4932
93 5M1J 19 L2 40S ribosomal protein S11-A 4932
94 5LL6 10 X 40S ribosomal protein S11-A 4932
95 5JUO 61 IB uS17 (yeast S11) 4932
96 5JUP 61 IB uS17 (yeast S11) 4932
97 5JUS 61 IB uS17 (yeast S11) 4932
98 5JUT 61 IB uS17 (yeast S11) 4932
99 5JUU 61 IB uS17 (yeast S11) 4932
100 5IT7 59 L KLLA0A10483p 28985
101 5IT9 12 L Ribosomal protein uS17 28985
102 3JAP 15 L uS17 28985
103 3JAQ 15 L uS17 28985
104 3JAM 13 L uS17 28985
105 4UER 27 Q US17 4934
106 3J81 13 L uS17 28985
107 3J80 10 L uS17 28985
108 3J77 57 11 40S ribosomal protein S11 4932
109 3J78 57 11 40S ribosomal protein S11 4932
110 3J6X 58 11 40S ribosomal protein S11 4932
111 3J6Y 58 11 40S ribosomal protein S11 4932
112 4V92 14 BL US17 28985
113 4V8Y 20 AL 40S RIBOSOMAL PROTEIN S11-A 4932
114 4V8Z 20 AL 40S RIBOSOMAL PROTEIN S11-A 4932
115 4V6I 18 AP 40S ribosomal protein rpS11 (S17p) 4932