6RXV

Cryo-EM structure of the 90S pre-ribosome (Kre33-Noc4) from Chaetomium thermophilum, state B2


Sequence Similarity Clusters for the Entities in PDB 6RXV

Entity #1 | Chains: UA
Periodic tryptophan protein 2-like protein protein, length: 904 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13487
95 % 3 7 13830
90 % 3 7 13638
70 % 3 7 12925
50 % 3 11 7683
40 % 3 11 7383
30 % 3 11 6945
Entity #10 | Chains: UM
Utp13 protein, length: 912 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13931
95 % 3 7 13558
90 % 3 7 13360
70 % 3 7 12662
50 % 3 7 11575
40 % 3 7 10869
30 % 3 7 10040
Entity #11 | Chains: UN
Utp14 protein, length: 938 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13840
95 % 3 7 13205
90 % 3 7 13002
70 % 3 7 12112
50 % 3 7 11278
40 % 3 7 10390
30 % 3 7 9792
Entity #12 | Chains: UO
Utp15 protein, length: 557 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13688
95 % 3 7 13058
90 % 3 7 12740
70 % 3 7 12243
50 % 3 7 11062
40 % 3 7 10492
30 % 3 9 8041
Entity #13 | Chains: UQ
Utp17 protein, length: 960 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13687
95 % 3 7 13057
90 % 3 7 12877
70 % 3 7 12242
50 % 3 7 11171
40 % 3 7 10491
30 % 3 7 9702
Entity #14 | Chains: UR
Utp18 protein, length: 618 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13140
95 % 3 7 13081
90 % 3 7 12901
70 % 3 7 12266
50 % 3 7 11196
40 % 3 7 10508
30 % 3 11 6770
Entity #15 | Chains: UU
Utp21 protein, length: 1049 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13436
95 % 3 7 13720
90 % 3 7 13529
70 % 3 7 12811
50 % 3 7 11716
40 % 3 7 11012
30 % 3 7 10170
Entity #16 | Chains: UX
Utp24 protein, length: 193 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 8 12615
95 % 3 8 11944
90 % 3 8 11803
70 % 3 8 11270
50 % 3 12 6695
40 % 3 12 6472
30 % 3 12 6143
Entity #17 | Chains: UZ
Utp30 protein, length: 391 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13932
95 % 3 7 13559
90 % 3 7 13361
70 % 3 7 12663
50 % 3 7 11576
40 % 3 7 10870
30 % 3 7 10041
Entity #18 | Chains: CA,CB
Nop1 protein, length: 313 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 5132
95 % 3 7 6131
90 % 3 7 6027
70 % 3 7 5936
50 % 3 11 3645
40 % 3 11 3610
30 % 3 11 3529
Entity #19 | Chains: CC
Nop56 protein, length: 523 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 14148
95 % 3 7 13945
90 % 3 7 13758
70 % 3 7 13039
50 % 3 11 7466
40 % 3 14 5886
30 % 3 14 5414
Entity #2 | Chains: UB
Utp2 protein, length: 907 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13924
95 % 3 7 13549
90 % 3 7 13346
70 % 3 7 12652
50 % 3 7 11561
40 % 3 7 10857
30 % 3 7 10028
Entity #20 | Chains: CD
Nop58 protein, length: 582 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13972
95 % 3 7 13633
90 % 3 7 13442
70 % 3 7 12735
50 % 3 7 11080
40 % 3 7 10935
30 % 3 7 10102
Entity #21 | Chains: CE,CF
Snu13 protein, length: 127 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 5360
95 % 3 7 6442
90 % 3 7 6446
70 % 3 7 6331
50 % 12 34 1418
40 % 13 35 1406
30 % 12 34 1495
Entity #22 | Chains: CG
Rrp9 protein, length: 630 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13963
95 % 3 7 13501
90 % 3 7 13297
70 % 3 7 12343
50 % 3 7 11514
40 % 3 7 10805
30 % 3 7 9982
Entity #23 | Chains: CH
RNA 3'-terminal phosphate cyclase-like protein protein, length: 411 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13888
95 % 3 7 13502
90 % 3 7 13333
70 % 3 7 12603
50 % 3 7 11515
40 % 3 7 10806
30 % 3 7 9983
Entity #24 | Chains: CI
Bms1 protein, length: 1163 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13889
95 % 3 7 13503
90 % 3 7 13298
70 % 3 7 12604
50 % 3 7 11516
40 % 3 11 7415
30 % 3 11 6969
Entity #25 | Chains: CJ
Imp3 protein, length: 183 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 8 10561
95 % 3 8 12839
90 % 3 8 11211
70 % 3 8 10761
50 % 3 12 7285
40 % 3 12 7010
30 % 3 12 6593
Entity #26 | Chains: CK
Imp4 protein, length: 297 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 8 11646
95 % 3 8 12513
90 % 3 8 12333
70 % 3 8 11749
50 % 3 11 7712
40 % 3 11 7412
30 % 3 11 6967
Entity #27 | Chains: CL
Mpp10 protein, length: 785 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13418
95 % 3 7 13669
90 % 3 7 13480
70 % 3 7 12765
50 % 3 7 11668
40 % 3 7 10964
30 % 3 7 10129
Entity #28 | Chains: CM
Sof1 protein, length: 446 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13890
95 % 3 7 13504
90 % 3 7 13299
70 % 3 7 12605
50 % 3 7 11517
40 % 3 9 8634
30 % 3 9 8098
Entity #29 | Chains: CN,CO
Emg1 protein, length: 252 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 5560
95 % 3 7 6474
90 % 3 7 6485
70 % 8 17 2487
50 % 8 17 2483
40 % 8 17 2483
30 % 8 17 2487
Entity #3 | Chains: UC
Utp3 protein, length: 648 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 14123
95 % 3 7 13903
90 % 3 7 13714
70 % 3 7 13000
50 % 3 7 11879
40 % 3 7 11154
30 % 3 7 10293
Entity #30 | Chains: CP
KRR1 small subunit processome component protein, length: 322 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 8 9122
95 % 3 8 9672
90 % 3 8 9580
70 % 3 11 7097
50 % 3 11 6488
40 % 3 11 6281
30 % 3 11 5989
Entity #31 | Chains: CQ
Pre-rRNA-processing protein PNO1 protein, length: 259 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13770
95 % 3 7 13227
90 % 3 7 13019
70 % 3 7 12373
50 % 3 7 11304
40 % 3 7 10603
30 % 3 7 9807
Entity #32 | Chains: CR,CS
Kre33 protein, length: 1073 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 8 4672
95 % 3 8 5362
90 % 3 8 5389
70 % 3 8 5331
50 % 3 8 5165
40 % 3 8 5193
30 % 3 8 4987
Entity #33 | Chains: CT
Fcf2 protein, length: 203 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13043
95 % 3 7 12983
90 % 3 7 12804
70 % 3 7 12169
50 % 3 7 11026
40 % 3 7 10355
30 % 3 7 9604
Entity #34 | Chains: Ca
40S ribosomal protein S1 protein, length: 255 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 5 18635
95 % 3 5 19009
90 % 3 5 17779
70 % 51 91 463
50 % 53 97 468
40 % 65 161 337
30 % 65 161 355
Entity #35 | Chains: Cb
40S ribosomal protein S4 protein, length: 264 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 5 21026
95 % 2 5 17982
90 % 2 5 18964
70 % 63 181 260
50 % 65 191 252
40 % 65 195 258
30 % 69 204 254
Entity #36 | Chains: Cc
40S ribosomal protein s5-like protein protein, length: 212 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13384
95 % 3 7 13228
90 % 3 7 13020
70 % 16 101 614
50 % 67 201 232
40 % 67 201 244
30 % 67 201 258
Entity #37 | Chains: Cd
40S ribosomal protein S6 protein, length: 239 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 5 20787
95 % 2 5 18945
90 % 2 5 18583
70 % 15 91 691
50 % 64 182 294
40 % 64 187 288
30 % 64 187 307
Entity #38 | Chains: Ce
40S ribosomal protein S7 protein, length: 203 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13801
95 % 3 7 13082
90 % 3 7 13092
70 % 3 7 12436
50 % 64 188 270
40 % 64 188 284
30 % 66 191 283
Entity #39 | Chains: Cf
40S ribosomal protein S8 protein, length: 202 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 5 20268
95 % 2 5 17872
90 % 2 5 18582
70 % 50 93 458
50 % 65 190 256
40 % 65 194 260
30 % 65 194 275
Entity #4 | Chains: UD
Utp4 protein, length: 884 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 4 8 9997
95 % 4 8 10444
90 % 4 8 10358
70 % 4 8 10034
50 % 4 8 9352
40 % 4 8 8922
30 % 4 8 8337
Entity #40 | Chains: Cg
40S ribosomal protein s9-like protein protein, length: 190 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13722
95 % 3 7 13518
90 % 3 7 12929
70 % 65 185 250
50 % 67 200 233
40 % 71 208 233
30 % 71 208 246
Entity #41 | Chains: Ch
40S ribosomal protein S13-like protein protein, length: 151 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13800
95 % 3 7 13296
90 % 3 7 13091
70 % 65 194 240
50 % 67 197 243
40 % 71 205 237
30 % 71 206 249
Entity #42 | Chains: Ci
40S ribosomal protein S14-like protein protein, length: 150 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13190
95 % 3 7 13204
90 % 15 81 762
70 % 67 198 224
50 % 67 199 237
40 % 67 199 247
30 % 67 199 260
Entity #43 | Chains: Cj
40S ribosomal protein S16-like protein protein, length: 143 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13416
95 % 3 7 13398
90 % 3 7 13183
70 % 3 7 12717
50 % 65 190 251
40 % 69 198 251
30 % 69 199 262
Entity #44 | Chains: Ck
40S ribosomal protein S11-like protein protein, length: 161 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 5 20620
95 % 2 5 18650
90 % 2 5 18496
70 % 51 95 448
50 % 66 197 242
40 % 66 197 253
30 % 66 197 266
Entity #45 | Chains: Cm
40S ribosomal protein S22-like protein protein, length: 130 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13802
95 % 3 7 13297
90 % 3 7 13093
70 % 66 201 232
50 % 73 212 221
40 % 74 214 227
30 % 74 214 238
Entity #46 | Chains: Cn
40S ribosomal protein s23-like protein protein, length: 145 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13360
95 % 3 7 13583
90 % 3 7 13386
70 % 67 204 214
50 % 71 214 219
40 % 71 214 228
30 % 71 214 239
Entity #47 | Chains: Co
40S ribosomal protein S24 protein, length: 136 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 5 18981
95 % 2 5 18010
90 % 2 5 18548
70 % 50 95 451
50 % 63 192 263
40 % 63 192 276
30 % 63 192 291
Entity #48 | Chains: Cp
40S ribosomal protein S28-like protein protein, length: 68 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13693
95 % 3 7 13091
90 % 3 7 13325
70 % 65 191 246
50 % 71 202 229
40 % 71 203 240
30 % 71 203 253
Entity #49 | Chains: CU
Faf1 protein, length: 311 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 14016
95 % 3 7 13709
90 % 3 7 13033
70 % 3 7 12391
50 % 3 7 11314
40 % 3 7 10616
30 % 3 7 9890
Entity #5 | Chains: UF
Utp6 protein, length: 414 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13141
95 % 3 7 13087
90 % 3 7 12902
70 % 3 7 12261
50 % 3 7 11190
40 % 3 7 10865
30 % 3 7 9715
Entity #50 | Chains: C1
35S ribosomal RNA rna, length: 2352 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
Entity #51 | Chains: C2
U3 snoRNA rna, length: 230 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
Entity #52 | Chains: UV
U3 small nucleolar RNA-associated protein 22 protein, length: 1171 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 4 31496
95 % 1 4 22891
90 % 1 4 22201
70 % 1 4 23566
50 % 1 4 20700
40 % 1 4 18795
30 % 1 4 16963
Entity #53 | Chains: CV
Rrp7 protein, length: 322 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 4 26372
95 % 1 4 26820
90 % 1 4 25928
70 % 1 4 23567
50 % 1 4 20701
40 % 1 4 18928
30 % 1 4 16964
Entity #54 | Chains: CW
Ribosome biogenesis protein ENP2 protein, length: 668 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 4 29533
95 % 2 4 23891
90 % 2 4 23164
70 % 2 4 21208
50 % 2 4 18756
40 % 2 4 17220
30 % 2 4 15532
Entity #55 | Chains: UT
Utp20 protein, length: 2612 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 4 31495
95 % 2 4 26818
90 % 2 4 25926
70 % 2 4 23565
50 % 2 4 20699
40 % 2 4 18926
30 % 2 4 16962
Entity #56 | Chains: UH
Utp8 protein, length: 930 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 6 17707
95 % 3 6 14923
90 % 3 6 15785
70 % 3 6 14829
50 % 3 6 12652
40 % 3 6 11812
30 % 3 6 10875
Entity #57 | Chains: UE,UI
Utp5 protein, length: 410 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 6 6213
95 % 3 6 8024
90 % 3 6 7986
70 % 3 6 7770
50 % 3 6 7307
40 % 3 6 7033
30 % 3 6 6616
Entity #58 | Chains: US
Noc4 protein, length: 549 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 6 15657
95 % 3 6 16271
90 % 3 6 15998
70 % 3 6 15779
50 % 3 6 13571
40 % 3 6 13228
30 % 3 6 12085
Entity #59 | Chains: Cl
Rps18 protein, length: 156 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 6 15656
95 % 3 6 16270
90 % 3 6 15997
70 % 65 183 254
50 % 67 192 248
40 % 71 202 241
30 % 71 202 255
Entity #6 | Chains: UG
Utp7 protein, length: 558 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 14144
95 % 3 7 13940
90 % 3 7 13753
70 % 3 7 12767
50 % 3 7 11670
40 % 3 9 8388
30 % 3 9 7851
Entity #60 | Chains: CX
Enp1 protein, length: 480 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 6 17640
95 % 3 6 15916
90 % 3 6 15666
70 % 3 6 14713
50 % 3 6 13303
40 % 3 6 12386
30 % 4 15 5228
Entity #61 | Chains: CY
U3 small nucleolar ribonucleoprotein protein lcp5-like protein protein, length: 381 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 3 36372
95 % 2 3 28708
90 % 2 3 27642
70 % 2 3 25019
50 % 2 3 21934
40 % 2 3 20058
30 % 2 3 17966
Entity #62 | Chains: CZ
Bfr2 protein, length: 609 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 4 25834
95 % 2 4 26120
90 % 2 4 25287
70 % 2 4 23011
50 % 2 4 20264
40 % 2 4 18540
30 % 2 4 16644
Entity #63 | Chains: UP
Utp16 protein, length: 364 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 6 16196
95 % 3 6 15741
90 % 3 6 15401
70 % 3 6 15679
50 % 3 6 14144
40 % 3 6 13145
30 % 3 6 12013
Entity #7 | Chains: UJ
UTP10 protein, length: 1802 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 8 11947
95 % 3 8 11185
90 % 3 8 11077
70 % 3 8 10647
50 % 3 8 9860
40 % 3 8 9399
30 % 3 8 8733
Entity #8 | Chains: UK
U3 small nucleolar RNA-associated protein 11 protein, length: 270 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13744
95 % 3 7 13163
90 % 3 7 12966
70 % 3 7 12331
50 % 3 7 11252
40 % 3 7 10569
30 % 3 7 9776
Entity #9 | Chains: UL
Utp12 protein, length: 962 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13743
95 % 3 7 13162
90 % 3 7 12965
70 % 3 7 12330
50 % 3 7 11901
40 % 3 11 7203
30 % 3 11 6771

Instructions

In the table for each entity, view a list of similar sequences by selecting the link associated with the percentage cutoff.



View more detailed documentation on the redundancy reduction and sequence clustering procedure used by RCSB PDB.

You can also use the structure comparison tool to compare any 2 given structures


ACTION - (A) Select for download / view details OR (B) Select two chains for comparison
Rank PDB ID Entity ID Chains Description Details Taxonomy EC Number
1 4V88 13 AL, CL 40S ribosomal protein S11-A 4932
2 4U4R 13 C1, c1 40S ribosomal protein S11-A 4932
3 4U3U 13 C1, c1 40S ribosomal protein S11-A 4932
4 5TBW 60 M, c1 40S ribosomal protein S11-A 4932
5 4U3M 13 C1, c1 40S ribosomal protein S11-A 4932
6 4U3N 13 C1, c1 40S ribosomal protein S11-A 4932
7 4U52 13 C1, c1 40S ribosomal protein S11-A 4932
8 4U4Q 13 C1, c1 40S ribosomal protein S11-A 4932
9 4U6F 13 C1, c1 40S ribosomal protein S11-A 4932
10 4U4U 13 C1, c1 40S ribosomal protein S11-A 4932
11 4U4Z 13 C1, c1 40S ribosomal protein S11-A 4932
12 4U4Y 13 C1, c1 40S ribosomal protein S11-A 4932
13 4U4N 13 C1, c1 40S ribosomal protein S11-A 4932
14 4U55 13 C1, c1 40S ribosomal protein S11-A 4932
15 5DAT 13 C1, c1 40S ribosomal protein S11-A 4932
16 5I4L 13 C1, c1 40S ribosomal protein S11-A 4932
17 4U51 13 C1, c1 40S ribosomal protein S11-A 4932
18 6HHQ 59 M, c1 40S ribosomal protein S11-A 4932
19 5OBM 57 C1, c1 40S ribosomal protein S11-A 4932
20 4U53 13 C1, c1 40S ribosomal protein S11-A 4932
21 5ON6 61 M, c1 40S ribosomal protein S11-A 4932
22 4U50 13 C1, c1 40S ribosomal protein S11-A 4932
23 5NDV 57 C1, c1 40S ribosomal protein S11-A 4932
24 5LYB 13 C1, c1 40S ribosomal protein S11-A,40S ribosomal protein S11-A,40S Ribosomal Protein S11-A 4932
25 4U56 13 C1, c1 40S ribosomal protein S11-A 4932
26 5TGA 13 C1, c1 40S ribosomal protein S11-A 4932
27 5MEI 60 M, c1 40S ribosomal protein S11-A 4932
28 5FCJ 13 C1, c1 40S ribosomal protein S11-A,40S ribosomal protein S11-A,40S ribosomal protein S11-A,40S ribosomal protein S11-A,40S ribosomal protein S11-A (uS17) (UNK) residues correspond to residues that aren't well resolved, and for which side-chains could not be modeled. (UNK)s were substituted in the original sequence of the crystallized protein. Remaining misalignments result from differences in the distribution of (UNK)s between the two instances of the molecule in the structure. Here is the original sequence ot the crystallized protein : STELTVQSERAFQKQPHIFNNPKVKTSKRTKRWYKNAGLGFKTPKTAIEGSYIDKKCPFTGLVSIRGKILTGTVVSTKMH RTIVIRRAYLHYIPKYNRYEKRHKNVPVHVSPAFRVQVGDIVTVGQCRPISKTVRFNVVKVSAAAAKANKQFAKF 4932
29 4U4O 13 C1, c1 40S ribosomal protein S11-A 4932
30 5DGV 13 C1, c1 40S ribosomal protein S11-A 4932
31 5DGE 13 C1, c1 40S ribosomal protein S11-A 4932
32 5NDW 6 C1, c1 40S ribosomal protein S11-A 4932
33 5NDG 13 C1, c1 40S ribosomal protein S11-A 4932
34 5FCI 13 C1, c1 40S ribosomal protein S11-A,40S ribosomal protein S11-A (uS17) (UNK) residues correspond to residues that aren't well resolved, and for which side-chains could not be modeled. (UNK)s were substituted in the original sequence of the crystallized protein. Remaining misalignments result from differences in the distribution of (UNK)s between the two instances of the molecule in the structure. Here is the original sequence ot the crystallized protein : STELTVQSERAFQKQPHIFNNPKVKTSKRTKRWYKNAGLGFKTPKTAIEGSYIDKKCPFTGLVSIRGKILTGTVVSTKMH RTIVIRRAYLHYIPKYNRYEKRHKNVPVHVSPAFRVQVGDIVTVGQCRPISKTVRFNVVKVSAAAAKANKQFAKF 4932
35 5DC3 13 C1, c1 40S ribosomal protein S11-A 4932
36 5DGF 13 C1, c1 40S ribosomal protein S11-A 4932
37 5TGM 13 C1, c1 40S ribosomal protein S11-A,40S Ribosomal Protein S11 4932
38 4V7R 7 AF, CF 40S ribosomal protein S11 4932
39 6Y7C 11 L 40S ribosomal protein S11-A 4932
40 6TNU 15 X 40S ribosomal protein S11-A 4932
41 6UZ7 59 L KLLA0A10483p 28985
42 6TB3 15 X 40S ribosomal protein S11-A 4932
43 6T83 14 Lb, m 40S ribosomal protein S11-A 4932
44 6T7T 16 SL 40S ribosomal protein S11-A 4932
45 6T7I 14 SL 40S ribosomal protein S11-A 4932
46 6T4Q 13 SL 40S ribosomal protein S11-A 4932
47 6SV4 30 X, Xb, Xc 40S ribosomal protein S11-A 4932
48 6SNT 14 L 40S ribosomal protein S11-A 4932
49 6S47 57 BM 40S ribosomal protein S11-A 4932
50 6RXU 44 Ck 40S ribosomal protein S11-like protein 209285
51 6RXV 44 Ck 40S ribosomal protein S11-like protein 209285
52 6RXX 41 Ck 40S ribosomal protein S11-like protein 209285
53 6RXZ 43 Ck 40S ribosomal protein S11-like protein 209285
54 6RBD 12 L 40S ribosomal protein S11-A 4932
55 6RBE 10 L 40S ribosomal protein S11-A 4932
56 6Q8Y 79 X 40S ribosomal protein S11-A 4932
57 6I7O 30 X, Xb 40S ribosomal protein S11-A 4932
58 6GSM 15 L KLLA0A10483p 28985
59 6GSN 36 L KLLA0A10483p 28985
60 6GQV 59 AB 40S ribosomal protein S11-A 4932
61 6GQ1 59 AB 40S ribosomal protein S11-A 4932
62 6GQB 59 AB 40S ribosomal protein S11-A 4932
63 6FYX 15 L KLLA0A10483p 28985
64 6FYY 15 L KLLA0A10483p 28985
65 6FAI 22 L 40S ribosomal protein S11-A 4932
66 6EML 20 X 40S ribosomal protein S11-A 4932
67 5OQL 44 v 40S ribosomal protein S11-like protein 209285
68 5WLC 12 LD rpS11_uS17 4932
69 5WYJ 42 SM 40S ribosomal protein S11-A 4932
70 5WYK 39 SM 40S ribosomal protein S11-A 4932
71 5TZS 13 D rpS11_uS17 4932
72 5MC6 25 X 40S ribosomal protein S11-A 4932
73 5M1J 19 L2 40S ribosomal protein S11-A 4932
74 5LL6 10 X 40S ribosomal protein S11-A 4932
75 5JUO 61 IB uS17 (yeast S11) 4932
76 5JUP 61 IB uS17 (yeast S11) 4932
77 5JUS 61 IB uS17 (yeast S11) 4932
78 5JUT 61 IB uS17 (yeast S11) 4932
79 5JUU 61 IB uS17 (yeast S11) 4932
80 5IT7 59 L KLLA0A10483p 28985
81 5IT9 12 L Ribosomal protein uS17 28985
82 3JAP 15 L uS17 28985
83 3JAQ 15 L uS17 28985
84 3JAM 13 L uS17 28985
85 4UER 27 Q US17 4934
86 3J81 13 L uS17 28985
87 3J80 10 L uS17 28985
88 3J77 57 11 40S ribosomal protein S11 4932
89 3J78 57 11 40S ribosomal protein S11 4932
90 3J6X 58 11 40S ribosomal protein S11 4932
91 3J6Y 58 11 40S ribosomal protein S11 4932
92 4V92 14 BL US17 28985
93 4V8Y 20 AL 40S RIBOSOMAL PROTEIN S11-A 4932
94 4V8Z 20 AL 40S RIBOSOMAL PROTEIN S11-A 4932
95 4V6I 18 AP 40S ribosomal protein rpS11 (S17p) 4932