6RXV

Cryo-EM structure of the 90S pre-ribosome (Kre33-Noc4) from Chaetomium thermophilum, state B2


Sequence Similarity Clusters for the Entities in PDB 6RXV

Entity #1 | Chains: UA
Periodic tryptophan protein 2-like protein protein, length: 904 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13092
95 % 3 7 12500
90 % 3 7 12306
70 % 3 7 11725
50 % 3 11 7127
40 % 3 11 6871
30 % 3 11 6447
Entity #10 | Chains: UM
Utp13 protein, length: 912 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 12541
95 % 3 7 12456
90 % 3 7 12520
70 % 3 7 11685
50 % 3 7 10890
40 % 3 7 10244
30 % 3 7 9295
Entity #11 | Chains: UN
Utp14 protein, length: 938 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 12903
95 % 3 7 13216
90 % 3 7 13030
70 % 3 7 12350
50 % 3 7 11301
40 % 3 7 10632
30 % 3 7 9809
Entity #12 | Chains: UO
Utp15 protein, length: 557 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13383
95 % 3 7 13055
90 % 3 7 12863
70 % 3 7 12214
50 % 3 7 11167
40 % 3 7 10510
30 % 3 9 7877
Entity #13 | Chains: UQ
Utp17 protein, length: 960 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13156
95 % 3 7 12599
90 % 3 7 12402
70 % 3 7 11802
50 % 3 7 10792
40 % 3 7 10153
30 % 3 7 9383
Entity #14 | Chains: UR
Utp18 protein, length: 618 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 12756
95 % 3 7 12916
90 % 3 7 12726
70 % 3 7 12104
50 % 3 7 11058
40 % 3 7 10393
30 % 3 11 6614
Entity #15 | Chains: UU
Utp21 protein, length: 1049 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13155
95 % 3 7 12598
90 % 3 7 12401
70 % 3 7 11801
50 % 3 7 10791
40 % 3 7 10152
30 % 3 7 9382
Entity #16 | Chains: UX
Utp24 protein, length: 193 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 8 12132
95 % 3 8 11533
90 % 3 8 11361
70 % 3 8 10886
50 % 3 12 6452
40 % 3 12 6252
30 % 3 12 5935
Entity #17 | Chains: UZ
Utp30 protein, length: 391 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13036
95 % 3 7 13315
90 % 3 7 13264
70 % 3 7 12105
50 % 3 7 11059
40 % 3 7 10394
30 % 3 7 9591
Entity #18 | Chains: CA,CB
Nop1 protein, length: 313 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 5426
95 % 3 7 6229
90 % 3 7 6252
70 % 3 7 6165
50 % 3 11 3621
40 % 3 11 3605
30 % 3 11 3523
Entity #19 | Chains: CC
Nop56 protein, length: 523 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13154
95 % 3 7 12597
90 % 3 7 12400
70 % 3 7 11800
50 % 3 11 7120
40 % 3 15 5060
30 % 3 15 4857
Entity #2 | Chains: UB
Utp2 protein, length: 907 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13552
95 % 3 7 13443
90 % 3 7 12761
70 % 3 7 12125
50 % 3 7 11464
40 % 3 7 10780
30 % 3 7 9939
Entity #20 | Chains: CD
Nop58 protein, length: 582 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 12639
95 % 3 7 12820
90 % 3 7 12623
70 % 3 7 11887
50 % 3 7 10870
40 % 3 7 10314
30 % 3 7 9520
Entity #21 | Chains: CE,CF
Snu13 protein, length: 127 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 5425
95 % 3 7 6228
90 % 3 7 6251
70 % 3 7 6164
50 % 12 34 1339
40 % 13 35 1328
30 % 12 34 1419
Entity #22 | Chains: CG
Rrp9 protein, length: 630 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 12884
95 % 3 7 13173
90 % 3 7 12994
70 % 3 7 12312
50 % 3 7 11263
40 % 3 7 10601
30 % 3 7 9775
Entity #23 | Chains: CH
RNA 3'-terminal phosphate cyclase-like protein protein, length: 411 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13348
95 % 3 7 12986
90 % 3 7 12797
70 % 3 7 12157
50 % 3 7 11114
40 % 3 7 10447
30 % 3 7 9638
Entity #24 | Chains: CI
Bms1 protein, length: 1163 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 12956
95 % 3 7 13309
90 % 3 7 13119
70 % 3 7 12434
50 % 3 7 11387
40 % 3 11 7171
30 % 3 11 6737
Entity #25 | Chains: CJ
Imp3 protein, length: 183 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 8 12134
95 % 3 8 11813
90 % 3 8 11644
70 % 3 8 11122
50 % 3 12 6862
40 % 3 12 6637
30 % 3 12 6251
Entity #26 | Chains: CK
Imp4 protein, length: 297 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 8 12133
95 % 3 8 10220
90 % 3 8 11643
70 % 3 8 9806
50 % 3 11 7441
40 % 3 11 7167
30 % 3 11 6734
Entity #27 | Chains: CL
Mpp10 protein, length: 785 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13349
95 % 3 7 12987
90 % 3 7 12798
70 % 3 7 11900
50 % 3 7 11115
40 % 3 7 10234
30 % 3 7 9639
Entity #28 | Chains: CM
Sof1 protein, length: 446 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13350
95 % 3 7 12988
90 % 3 7 12799
70 % 3 7 12158
50 % 3 7 11116
40 % 3 9 8359
30 % 3 9 7806
Entity #29 | Chains: CN,CO
Emg1 protein, length: 252 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 4990
95 % 3 7 5911
90 % 3 7 5956
70 % 8 17 2319
50 % 8 17 2371
40 % 8 17 2388
30 % 8 17 2378
Entity #3 | Chains: UC
Utp3 protein, length: 648 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13093
95 % 3 7 12956
90 % 3 7 12307
70 % 3 7 11726
50 % 3 7 10714
40 % 3 7 10081
30 % 3 7 9323
Entity #30 | Chains: CP
KRR1 small subunit processome component protein, length: 322 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 8 9285
95 % 3 8 9519
90 % 3 8 9452
70 % 3 11 6841
50 % 3 11 6500
40 % 3 11 6297
30 % 3 11 5965
Entity #31 | Chains: CQ
Pre-rRNA-processing protein PNO1 protein, length: 259 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 12757
95 % 3 7 12917
90 % 3 7 12727
70 % 3 7 12106
50 % 3 7 11061
40 % 3 7 10395
30 % 3 7 9592
Entity #32 | Chains: CR,CS
Kre33 protein, length: 1073 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 8 4095
95 % 3 8 5017
90 % 3 8 5074
70 % 3 8 5020
50 % 3 8 4873
40 % 3 8 4765
30 % 3 8 4610
Entity #33 | Chains: CT
Fcf2 protein, length: 203 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 12958
95 % 3 7 13314
90 % 3 7 13123
70 % 3 7 12437
50 % 3 7 11389
40 % 3 7 10711
30 % 3 7 9876
Entity #34 | Chains: Ca
40S ribosomal protein S1 protein, length: 255 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 5 18280
95 % 3 5 17403
90 % 3 5 17055
70 % 46 86 468
50 % 51 142 348
40 % 53 149 346
30 % 53 149 362
Entity #35 | Chains: Cb
40S ribosomal protein S4 protein, length: 264 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 5 17910
95 % 2 5 16818
90 % 2 5 16580
70 % 50 168 264
50 % 52 178 261
40 % 52 182 263
30 % 52 187 263
Entity #36 | Chains: Cc
40S ribosomal protein s5-like protein protein, length: 212 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13545
95 % 3 7 13387
90 % 3 7 13204
70 % 8 93 626
50 % 54 188 233
40 % 54 188 241
30 % 54 188 253
Entity #37 | Chains: Cd
40S ribosomal protein S6 protein, length: 239 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 5 19391
95 % 2 5 17254
90 % 2 5 16919
70 % 7 83 712
50 % 51 169 299
40 % 51 174 300
30 % 51 174 324
Entity #38 | Chains: Ce
40S ribosomal protein S7 protein, length: 203 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13224
95 % 3 7 12747
90 % 3 7 12546
70 % 3 7 11937
50 % 51 175 282
40 % 51 175 293
30 % 53 178 296
Entity #39 | Chains: Cf
40S ribosomal protein S8 protein, length: 202 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 5 19390
95 % 2 5 17253
90 % 2 5 16918
70 % 45 88 456
50 % 52 177 265
40 % 52 181 264
30 % 52 181 285
Entity #4 | Chains: UD
Utp4 protein, length: 884 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 4 8 9204
95 % 4 8 9366
90 % 4 8 9295
70 % 4 8 9033
50 % 4 8 8393
40 % 4 8 8070
30 % 4 8 7528
Entity #40 | Chains: Cg
40S ribosomal protein s9-like protein protein, length: 190 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13223
95 % 3 7 12746
90 % 3 7 12545
70 % 52 172 257
50 % 54 187 234
40 % 54 191 239
30 % 54 191 249
Entity #41 | Chains: Ch
40S ribosomal protein S13-like protein protein, length: 151 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13255
95 % 3 7 12802
90 % 3 7 12605
70 % 52 181 243
50 % 54 184 241
40 % 54 189 240
30 % 54 189 252
Entity #42 | Chains: Ci
40S ribosomal protein S14-like protein protein, length: 150 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13301
95 % 3 7 12894
90 % 7 73 795
70 % 54 185 219
50 % 54 186 235
40 % 54 186 245
30 % 54 186 260
Entity #43 | Chains: Cj
40S ribosomal protein S16-like protein protein, length: 143 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13225
95 % 3 7 12748
90 % 3 7 12547
70 % 3 7 11938
50 % 54 179 252
40 % 54 183 253
30 % 54 184 267
Entity #44 | Chains: Ck
40S ribosomal protein S11-like protein protein, length: 161 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 5 19896
95 % 2 5 18070
90 % 2 5 17727
70 % 46 90 438
50 % 53 184 240
40 % 53 184 248
30 % 53 184 266
Entity #45 | Chains: Cm
40S ribosomal protein S22-like protein protein, length: 130 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13398
95 % 3 7 13085
90 % 3 7 12903
70 % 53 188 227
50 % 56 195 228
40 % 56 195 235
30 % 414 752 23
Entity #46 | Chains: Cn
40S ribosomal protein s23-like protein protein, length: 145 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13440
95 % 3 7 12719
90 % 3 7 12670
70 % 54 191 210
50 % 54 197 224
40 % 54 197 232
30 % 54 197 245
Entity #47 | Chains: Co
40S ribosomal protein S24 protein, length: 136 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 5 20258
95 % 2 5 18233
90 % 2 5 18170
70 % 2 5 16212
50 % 50 179 270
40 % 50 179 281
30 % 50 179 305
Entity #48 | Chains: Cp
40S ribosomal protein S28-like protein protein, length: 68 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13302
95 % 3 7 12895
90 % 3 7 12993
70 % 52 178 249
50 % 54 185 236
40 % 54 186 244
30 % 54 186 258
Entity #49 | Chains: CU
Faf1 protein, length: 311 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13399
95 % 3 7 13086
90 % 3 7 12904
70 % 3 7 12406
50 % 3 7 11357
40 % 3 7 10681
30 % 3 7 9716
Entity #5 | Chains: UF
Utp6 protein, length: 414 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 12962
95 % 3 7 13317
90 % 3 7 13213
70 % 3 7 12444
50 % 3 7 11393
40 % 3 7 10714
30 % 3 7 9882
Entity #50 | Chains: C1
35S ribosomal RNA rna, length: 2352 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
Entity #51 | Chains: C2
U3 snoRNA rna, length: 230 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
Entity #52 | Chains: UV
U3 small nucleolar RNA-associated protein 22 protein, length: 1171 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 4 29130
95 % 1 4 24091
90 % 1 4 23359
70 % 1 4 19517
50 % 1 4 17345
40 % 1 4 17358
30 % 1 4 15636
Entity #53 | Chains: CV
Rrp7 protein, length: 322 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 4 25361
95 % 1 4 25637
90 % 1 4 24819
70 % 1 4 22643
50 % 1 4 19951
40 % 1 4 18284
30 % 1 4 16405
Entity #54 | Chains: CW
Ribosome biogenesis protein ENP2 protein, length: 668 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 4 26688
95 % 2 4 20737
90 % 2 4 20240
70 % 2 4 18678
50 % 2 4 18149
40 % 2 4 16722
30 % 2 4 13984
Entity #55 | Chains: UT
Utp20 protein, length: 2612 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 4 30240
95 % 2 4 23535
90 % 2 4 22838
70 % 2 4 22516
50 % 2 4 19846
40 % 2 4 18201
30 % 2 4 15367
Entity #56 | Chains: UH
Utp8 protein, length: 930 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 6 16152
95 % 3 6 13749
90 % 3 6 13529
70 % 3 6 12679
50 % 3 6 11992
40 % 3 6 11261
30 % 3 6 10361
Entity #57 | Chains: UE,UI
Utp5 protein, length: 410 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 6 6668
95 % 3 6 7271
90 % 3 6 7260
70 % 3 6 6809
50 % 3 6 6479
40 % 3 6 6524
30 % 3 6 6175
Entity #58 | Chains: US
Noc4 protein, length: 549 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 6 16321
95 % 3 6 15418
90 % 3 6 15178
70 % 3 6 13625
50 % 3 6 12968
40 % 3 6 12090
30 % 3 6 11085
Entity #59 | Chains: Cl
Rps18 protein, length: 156 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 6 17347
95 % 3 6 15905
90 % 3 6 15653
70 % 52 170 260
50 % 54 179 258
40 % 54 185 247
30 % 54 185 265
Entity #6 | Chains: UG
Utp7 protein, length: 558 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 12961
95 % 3 7 13316
90 % 3 7 13128
70 % 3 7 12443
50 % 3 7 11392
40 % 3 9 8134
30 % 3 9 7579
Entity #60 | Chains: CX
Enp1 protein, length: 480 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 6 17817
95 % 3 6 16669
90 % 3 6 16375
70 % 3 6 15311
50 % 3 6 13841
40 % 3 6 12871
30 % 3 14 5191
Entity #61 | Chains: CY
U3 small nucleolar ribonucleoprotein protein lcp5-like protein protein, length: 381 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 3 33848
95 % 2 3 26678
90 % 2 3 25755
70 % 2 3 22994
50 % 2 3 20237
40 % 2 3 18530
30 % 2 3 16620
Entity #62 | Chains: CZ
Bfr2 protein, length: 609 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 4 28348
95 % 2 4 23046
90 % 2 4 22396
70 % 2 4 20514
50 % 2 4 18161
40 % 2 4 16735
30 % 2 4 15131
Entity #63 | Chains: UP
Utp16 protein, length: 364 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 6 15827
95 % 3 6 14263
90 % 3 6 15941
70 % 3 6 12676
50 % 3 6 11595
40 % 3 6 10905
30 % 3 6 10063
Entity #7 | Chains: UJ
UTP10 protein, length: 1802 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 8 10870
95 % 3 8 12096
90 % 3 8 11922
70 % 3 8 11347
50 % 3 8 10410
40 % 3 8 9813
30 % 3 8 9086
Entity #8 | Chains: UK
U3 small nucleolar RNA-associated protein 11 protein, length: 270 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 12963
95 % 3 7 13318
90 % 3 7 13129
70 % 3 7 12445
50 % 3 7 11394
40 % 3 7 10715
30 % 3 7 9883
Entity #9 | Chains: UL
Utp12 protein, length: 962 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13578
95 % 3 7 13432
90 % 3 7 13243
70 % 3 7 12561
50 % 3 7 11499
40 % 3 11 6977
30 % 3 11 6538

Instructions

In the table for each entity, view a list of similar sequences by selecting the link associated with the percentage cutoff.



View more detailed documentation on the redundancy reduction and sequence clustering procedure used by RCSB PDB.

You can also use the structure comparison tool to compare any 2 given structures


ACTION - (A) Select for download / view details OR (B) Select two chains for comparison
Rank PDB ID Entity ID Chains Description Details Taxonomy EC Number
1 4V88 13 AL, CL 40S ribosomal protein S11-A 4932
2 4U4R 13 C1, c1 40S ribosomal protein S11-A 4932
3 4U3U 13 C1, c1 40S ribosomal protein S11-A 4932
4 5TBW 60 M, c1 40S ribosomal protein S11-A 4932
5 4U3M 13 C1, c1 40S ribosomal protein S11-A 4932
6 4U3N 13 C1, c1 40S ribosomal protein S11-A 4932
7 4U52 13 C1, c1 40S ribosomal protein S11-A 4932
8 4U4Q 13 C1, c1 40S ribosomal protein S11-A 4932
9 4U6F 13 C1, c1 40S ribosomal protein S11-A 4932
10 4U4U 13 C1, c1 40S ribosomal protein S11-A 4932
11 4U4Z 13 C1, c1 40S ribosomal protein S11-A 4932
12 4U4Y 13 C1, c1 40S ribosomal protein S11-A 4932
13 4U4N 13 C1, c1 40S ribosomal protein S11-A 4932
14 4U55 13 C1, c1 40S ribosomal protein S11-A 4932
15 5DAT 13 C1, c1 40S ribosomal protein S11-A 4932
16 5I4L 13 C1, c1 40S ribosomal protein S11-A 4932
17 4U51 13 C1, c1 40S ribosomal protein S11-A 4932
18 6HHQ 59 M, c1 40S ribosomal protein S11-A 4932
19 5OBM 57 C1, c1 40S ribosomal protein S11-A 4932
20 4U53 13 C1, c1 40S ribosomal protein S11-A 4932
21 5ON6 61 M, c1 40S ribosomal protein S11-A 4932
22 4U50 13 C1, c1 40S ribosomal protein S11-A 4932
23 5NDV 57 C1, c1 40S ribosomal protein S11-A 4932
24 5LYB 13 C1, c1 40S ribosomal protein S11-A,40S ribosomal protein S11-A,40S Ribosomal Protein S11-A 4932
25 4U56 13 C1, c1 40S ribosomal protein S11-A 4932
26 5TGA 13 C1, c1 40S ribosomal protein S11-A 4932
27 5MEI 60 M, c1 40S ribosomal protein S11-A 4932
28 5FCJ 13 C1, c1 40S ribosomal protein S11-A,40S ribosomal protein S11-A,40S ribosomal protein S11-A,40S ribosomal protein S11-A,40S ribosomal protein S11-A (uS17) (UNK) residues correspond to residues that aren't well resolved, and for which side-chains could not be modeled. (UNK)s were substituted in the original sequence of the crystallized protein. Remaining misalignments result from differences in the distribution of (UNK)s between the two instances of the molecule in the structure. Here is the original sequence ot the crystallized protein : STELTVQSERAFQKQPHIFNNPKVKTSKRTKRWYKNAGLGFKTPKTAIEGSYIDKKCPFTGLVSIRGKILTGTVVSTKMH RTIVIRRAYLHYIPKYNRYEKRHKNVPVHVSPAFRVQVGDIVTVGQCRPISKTVRFNVVKVSAAAAKANKQFAKF 4932
29 4U4O 13 C1, c1 40S ribosomal protein S11-A 4932
30 5DGV 13 C1, c1 40S ribosomal protein S11-A 4932
31 5DGE 13 C1, c1 40S ribosomal protein S11-A 4932
32 5NDW 6 C1, c1 40S ribosomal protein S11-A 4932
33 5NDG 13 C1, c1 40S ribosomal protein S11-A 4932
34 5FCI 13 C1, c1 40S ribosomal protein S11-A,40S ribosomal protein S11-A (uS17) (UNK) residues correspond to residues that aren't well resolved, and for which side-chains could not be modeled. (UNK)s were substituted in the original sequence of the crystallized protein. Remaining misalignments result from differences in the distribution of (UNK)s between the two instances of the molecule in the structure. Here is the original sequence ot the crystallized protein : STELTVQSERAFQKQPHIFNNPKVKTSKRTKRWYKNAGLGFKTPKTAIEGSYIDKKCPFTGLVSIRGKILTGTVVSTKMH RTIVIRRAYLHYIPKYNRYEKRHKNVPVHVSPAFRVQVGDIVTVGQCRPISKTVRFNVVKVSAAAAKANKQFAKF 4932
35 5DC3 13 C1, c1 40S ribosomal protein S11-A 4932
36 5DGF 13 C1, c1 40S ribosomal protein S11-A 4932
37 5TGM 13 C1, c1 40S ribosomal protein S11-A,40S Ribosomal Protein S11 4932
38 4V7R 7 AF, CF 40S ribosomal protein S11 4932
39 6UZ7 59 L KLLA0A10483p 28985
40 6T83 14 Lb, m 40S ribosomal protein S11-A 4932
41 6T7T 14 SL 40S ribosomal protein S11-A 4932
42 6T7I 14 SL 40S ribosomal protein S11-A 4932
43 6T4Q 13 SL 40S ribosomal protein S11-A 4932
44 6S47 57 BM 40S ribosomal protein S11-A 4932
45 6RXU 44 Ck 40S ribosomal protein S11-like protein 209285
46 6RXV 44 Ck 40S ribosomal protein S11-like protein 209285
47 6RXX 41 Ck 40S ribosomal protein S11-like protein 209285
48 6RXZ 43 Ck 40S ribosomal protein S11-like protein 209285
49 6RBD 12 L 40S ribosomal protein S11-A 4932
50 6RBE 10 L 40S ribosomal protein S11-A 4932
51 6Q8Y 79 X 40S ribosomal protein S11-A 4932
52 6I7O 30 X, Xb 40S ribosomal protein S11-A 4932
53 6GSM 15 L KLLA0A10483p 28985
54 6GSN 36 L KLLA0A10483p 28985
55 6GQV 59 AB 40S ribosomal protein S11-A 4932
56 6GQ1 59 AB 40S ribosomal protein S11-A 4932
57 6GQB 59 AB 40S ribosomal protein S11-A 4932
58 6FYX 15 L KLLA0A10483p 28985
59 6FYY 15 L KLLA0A10483p 28985
60 6FAI 22 L 40S ribosomal protein S11-A 4932
61 6EML 20 X 40S ribosomal protein S11-A 4932
62 5OQL 44 v 40S ribosomal protein S11-like protein 209285
63 5WLC 12 LD rpS11_uS17 4932
64 5WYJ 42 SM 40S ribosomal protein S11-A 4932
65 5WYK 39 SM 40S ribosomal protein S11-A 4932
66 5TZS 13 D rpS11_uS17 4932
67 5MC6 25 X 40S ribosomal protein S11-A 4932
68 5M1J 19 L2 40S ribosomal protein S11-A 4932
69 5LL6 10 X 40S ribosomal protein S11-A 4932
70 5JUO 61 IB uS17 (yeast S11) 4932
71 5JUP 61 IB uS17 (yeast S11) 4932
72 5JUS 61 IB uS17 (yeast S11) 4932
73 5JUT 61 IB uS17 (yeast S11) 4932
74 5JUU 61 IB uS17 (yeast S11) 4932
75 5IT7 59 L KLLA0A10483p 28985
76 5IT9 12 L Ribosomal protein uS17 28985
77 3JAP 15 L uS17 28985
78 3JAQ 15 L uS17 28985
79 3JAM 13 L uS17 28985
80 4UER 27 Q US17 4934
81 3J81 13 L uS17 28985
82 3J80 10 L uS17 28985
83 3J77 57 11 40S ribosomal protein S11 4932
84 3J78 57 11 40S ribosomal protein S11 4932
85 3J6X 58 11 40S ribosomal protein S11 4932
86 3J6Y 58 11 40S ribosomal protein S11 4932
87 4V92 14 BL US17 28985
88 4V8Y 20 AL 40S RIBOSOMAL PROTEIN S11-A 4932
89 4V8Z 20 AL 40S RIBOSOMAL PROTEIN S11-A 4932
90 4V6I 18 AP 40S ribosomal protein rpS11 (S17p) 4932