6RXV

Cryo-EM structure of the 90S pre-ribosome (Kre33-Noc4) from Chaetomium thermophilum, state B2


Sequence Similarity Clusters for the Entities in PDB 6RXV

Entity #1 | Chains: UA
Periodic tryptophan protein 2-like protein protein, length: 904 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13207
95 % 3 7 13555
90 % 3 7 13384
70 % 3 7 12682
50 % 3 11 7514
40 % 3 11 7235
30 % 3 11 6796
Entity #10 | Chains: UM
Utp13 protein, length: 912 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13150
95 % 3 7 13448
90 % 3 7 13278
70 % 3 7 12585
50 % 3 7 11494
40 % 3 7 10804
30 % 3 7 9964
Entity #11 | Chains: UN
Utp14 protein, length: 938 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13536
95 % 3 7 13113
90 % 3 7 13015
70 % 3 7 12280
50 % 3 7 11057
40 % 3 7 10194
30 % 3 7 9610
Entity #12 | Chains: UO
Utp15 protein, length: 557 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 12983
95 % 3 7 13149
90 % 3 7 12962
70 % 3 7 12307
50 % 3 7 11233
40 % 3 7 10547
30 % 3 9 7867
Entity #13 | Chains: UQ
Utp17 protein, length: 960 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13306
95 % 3 7 12851
90 % 3 7 13533
70 % 3 7 11889
50 % 3 7 10834
40 % 3 7 10184
30 % 3 7 9426
Entity #14 | Chains: UR
Utp18 protein, length: 618 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 12870
95 % 3 7 13294
90 % 3 7 13108
70 % 3 7 12439
50 % 3 7 11350
40 % 3 7 10669
30 % 3 11 6608
Entity #15 | Chains: UU
Utp21 protein, length: 1049 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 12765
95 % 3 7 12666
90 % 3 7 12493
70 % 3 7 11904
50 % 3 7 10847
40 % 3 7 10195
30 % 3 7 9436
Entity #16 | Chains: UX
Utp24 protein, length: 193 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 8 12345
95 % 3 8 11721
90 % 3 8 11591
70 % 3 8 11078
50 % 3 12 7008
40 % 3 12 6768
30 % 3 12 6369
Entity #17 | Chains: UZ
Utp30 protein, length: 391 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13074
95 % 3 7 13312
90 % 3 7 13126
70 % 3 7 12454
50 % 3 7 11365
40 % 3 7 10677
30 % 3 7 9852
Entity #18 | Chains: CA,CB
Nop1 protein, length: 313 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 5522
95 % 3 7 6325
90 % 3 7 6341
70 % 3 7 6262
50 % 3 11 3534
40 % 3 11 3520
30 % 3 11 3441
Entity #19 | Chains: CC
Nop56 protein, length: 523 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13206
95 % 3 7 13148
90 % 3 7 12961
70 % 3 7 12306
50 % 3 11 7212
40 % 3 14 5446
30 % 3 14 5203
Entity #2 | Chains: UB
Utp2 protein, length: 907 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13828
95 % 3 7 13670
90 % 3 7 13495
70 % 3 7 12793
50 % 3 7 11685
40 % 3 7 10980
30 % 3 7 10136
Entity #20 | Chains: CD
Nop58 protein, length: 582 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13831
95 % 3 7 13681
90 % 3 7 13502
70 % 3 7 12799
50 % 3 7 11692
40 % 3 7 10987
30 % 3 7 10142
Entity #21 | Chains: CE,CF
Snu13 protein, length: 127 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 5505
95 % 3 7 6303
90 % 3 7 6315
70 % 3 7 6244
50 % 12 34 1379
40 % 13 35 1362
30 % 12 34 1456
Entity #22 | Chains: CG
Rrp9 protein, length: 630 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13662
95 % 3 7 12773
90 % 3 7 13181
70 % 3 7 12379
50 % 3 7 11407
40 % 3 7 10614
30 % 3 7 9798
Entity #23 | Chains: CH
RNA 3'-terminal phosphate cyclase-like protein protein, length: 411 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13702
95 % 3 7 13073
90 % 3 7 13263
70 % 3 7 12572
50 % 3 7 11479
40 % 3 7 10793
30 % 3 7 9955
Entity #24 | Chains: CI
Bms1 protein, length: 1163 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13202
95 % 3 7 13545
90 % 3 7 13378
70 % 3 7 12676
50 % 3 7 11586
40 % 3 11 7266
30 % 3 11 6823
Entity #25 | Chains: CJ
Imp3 protein, length: 183 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 8 11058
95 % 3 8 10671
90 % 3 8 10586
70 % 3 8 11540
50 % 3 12 7052
40 % 3 12 6826
30 % 3 12 6406
Entity #26 | Chains: CK
Imp4 protein, length: 297 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 8 11081
95 % 3 8 10451
90 % 3 8 12137
70 % 3 8 11572
50 % 3 11 7542
40 % 3 11 7263
30 % 3 11 6819
Entity #27 | Chains: CL
Mpp10 protein, length: 785 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13133
95 % 3 7 13418
90 % 3 7 13241
70 % 3 7 12543
50 % 3 7 11452
40 % 3 7 10766
30 % 3 7 9935
Entity #28 | Chains: CM
Sof1 protein, length: 446 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13594
95 % 3 7 13235
90 % 3 7 13043
70 % 3 7 12380
50 % 3 7 11299
40 % 3 9 8483
30 % 3 9 7930
Entity #29 | Chains: CN,CO
Emg1 protein, length: 252 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 5396
95 % 3 7 6095
90 % 3 7 6124
70 % 8 17 2374
50 % 8 17 2404
40 % 8 17 2425
30 % 8 17 2453
Entity #3 | Chains: UC
Utp3 protein, length: 648 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 12841
95 % 3 7 12843
90 % 3 7 12657
70 % 3 7 11875
50 % 3 7 10983
40 % 3 7 10324
30 % 3 7 9543
Entity #30 | Chains: CP
KRR1 small subunit processome component protein, length: 322 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 8 9545
95 % 3 8 10194
90 % 3 8 10117
70 % 3 11 7211
50 % 3 11 7115
40 % 3 11 6873
30 % 3 11 6459
Entity #31 | Chains: CQ
Pre-rRNA-processing protein PNO1 protein, length: 259 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13408
95 % 3 7 13425
90 % 3 7 12693
70 % 3 7 12144
50 % 3 7 11003
40 % 3 7 10336
30 % 3 7 9558
Entity #32 | Chains: CR,CS
Kre33 protein, length: 1073 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 8 4192
95 % 3 8 5126
90 % 3 8 5194
70 % 3 8 5144
50 % 3 8 4995
40 % 3 8 4867
30 % 3 8 4697
Entity #33 | Chains: CT
Fcf2 protein, length: 203 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 12738
95 % 3 7 12653
90 % 3 7 12567
70 % 3 7 11855
50 % 3 7 10808
40 % 3 7 10255
30 % 3 7 9490
Entity #34 | Chains: Ca
40S ribosomal protein S1 protein, length: 255 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 5 18549
95 % 3 5 17671
90 % 3 5 17358
70 % 49 89 456
50 % 54 145 354
40 % 56 152 349
30 % 56 152 364
Entity #35 | Chains: Cb
40S ribosomal protein S4 protein, length: 264 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 5 20343
95 % 2 5 18610
90 % 2 5 18278
70 % 53 171 266
50 % 55 181 258
40 % 55 185 263
30 % 59 194 258
Entity #36 | Chains: Cc
40S ribosomal protein s5-like protein protein, length: 212 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13809
95 % 3 7 13623
90 % 3 7 13454
70 % 8 93 647
50 % 57 191 236
40 % 57 191 247
30 % 57 191 262
Entity #37 | Chains: Cd
40S ribosomal protein S6 protein, length: 239 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 5 20342
95 % 2 5 18609
90 % 2 5 18277
70 % 7 83 736
50 % 54 172 301
40 % 54 177 297
30 % 54 177 323
Entity #38 | Chains: Ce
40S ribosomal protein S7 protein, length: 203 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13811
95 % 3 7 13625
90 % 3 7 13456
70 % 3 7 12755
50 % 54 178 277
40 % 54 178 290
30 % 56 181 291
Entity #39 | Chains: Cf
40S ribosomal protein S8 protein, length: 202 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 5 19805
95 % 2 5 17518
90 % 2 5 17376
70 % 48 91 447
50 % 55 180 260
40 % 55 184 267
30 % 55 184 282
Entity #4 | Chains: UD
Utp4 protein, length: 884 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 4 8 9271
95 % 4 8 10154
90 % 4 8 10075
70 % 4 8 9758
50 % 4 8 9092
40 % 4 8 8684
30 % 4 8 8109
Entity #40 | Chains: Cg
40S ribosomal protein s9-like protein protein, length: 190 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13648
95 % 3 7 13332
90 % 3 7 13150
70 % 55 175 253
50 % 57 190 239
40 % 61 198 233
30 % 61 198 249
Entity #41 | Chains: Ch
40S ribosomal protein S13-like protein protein, length: 151 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13454
95 % 3 7 12958
90 % 3 7 12777
70 % 55 180 247
50 % 57 187 243
40 % 61 195 238
30 % 61 196 254
Entity #42 | Chains: Ci
40S ribosomal protein S14-like protein protein, length: 150 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 12833
95 % 3 7 13016
90 % 7 73 809
70 % 57 188 220
50 % 57 189 240
40 % 57 189 252
30 % 57 189 267
Entity #43 | Chains: Cj
40S ribosomal protein S16-like protein protein, length: 143 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13386
95 % 3 7 12821
90 % 3 7 12539
70 % 3 7 12033
50 % 57 182 253
40 % 61 190 249
30 % 61 191 263
Entity #44 | Chains: Ck
40S ribosomal protein S11-like protein protein, length: 161 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 5 20207
95 % 2 5 18365
90 % 2 5 18047
70 % 49 93 435
50 % 56 187 242
40 % 56 187 255
30 % 56 187 269
Entity #45 | Chains: Cm
40S ribosomal protein S22-like protein protein, length: 130 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13796
95 % 3 7 13063
90 % 3 7 13438
70 % 56 191 223
50 % 63 202 215
40 % 63 202 229
30 % 425 763 22
Entity #46 | Chains: Cn
40S ribosomal protein s23-like protein protein, length: 145 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13081
95 % 3 7 13319
90 % 3 7 13138
70 % 57 194 197
50 % 61 204 211
40 % 61 204 227
30 % 61 204 244
Entity #47 | Chains: Co
40S ribosomal protein S24 protein, length: 136 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 5 18989
95 % 2 5 18419
90 % 2 5 18102
70 % 48 93 438
50 % 53 182 268
40 % 53 182 279
30 % 53 182 304
Entity #48 | Chains: Cp
40S ribosomal protein S28-like protein protein, length: 68 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13649
95 % 3 7 13333
90 % 3 7 13342
70 % 55 181 244
50 % 61 192 233
40 % 61 193 242
30 % 61 193 257
Entity #49 | Chains: CU
Faf1 protein, length: 311 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13387
95 % 3 7 12822
90 % 3 7 12640
70 % 3 7 12034
50 % 3 7 10972
40 % 3 7 10315
30 % 3 7 9537
Entity #5 | Chains: UF
Utp6 protein, length: 414 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13242
95 % 3 7 13554
90 % 3 7 13257
70 % 3 7 12681
50 % 3 7 11592
40 % 3 7 10891
30 % 3 7 10047
Entity #50 | Chains: C1
35S ribosomal RNA rna, length: 2352 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
Entity #51 | Chains: C2
U3 snoRNA rna, length: 230 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
Entity #52 | Chains: UV
U3 small nucleolar RNA-associated protein 22 protein, length: 1171 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 4 30533
95 % 1 4 25672
90 % 1 4 24842
70 % 1 4 22653
50 % 1 4 19953
40 % 1 4 18274
30 % 1 4 16400
Entity #53 | Chains: CV
Rrp7 protein, length: 322 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 4 25820
95 % 1 4 26295
90 % 1 4 25215
70 % 1 4 22969
50 % 1 4 20357
40 % 1 4 18500
30 % 1 4 16591
Entity #54 | Chains: CW
Ribosome biogenesis protein ENP2 protein, length: 668 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 4 28887
95 % 2 4 23406
90 % 2 4 22733
70 % 2 4 20806
50 % 2 4 18421
40 % 2 4 16926
30 % 2 4 15269
Entity #55 | Chains: UT
Utp20 protein, length: 2612 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 4 24042
95 % 2 4 25917
90 % 2 4 25086
70 % 2 4 22858
50 % 2 4 18738
40 % 2 4 18417
30 % 2 4 15507
Entity #56 | Chains: UH
Utp8 protein, length: 930 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 6 16064
95 % 3 6 17074
90 % 3 6 16775
70 % 3 6 15684
50 % 3 6 14155
40 % 3 6 13153
30 % 3 6 12005
Entity #57 | Chains: UE,UI
Utp5 protein, length: 410 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 6 7234
95 % 3 6 7825
90 % 3 6 7797
70 % 3 6 7603
50 % 3 6 7151
40 % 3 6 6904
30 % 3 6 6481
Entity #58 | Chains: US
Noc4 protein, length: 549 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 6 17319
95 % 3 6 15703
90 % 3 6 14423
70 % 3 6 13894
50 % 3 6 12621
40 % 3 6 11790
30 % 3 6 11255
Entity #59 | Chains: Cl
Rps18 protein, length: 156 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 6 16063
95 % 3 6 17073
90 % 3 6 16774
70 % 55 173 260
50 % 57 182 255
40 % 61 192 246
30 % 61 192 261
Entity #6 | Chains: UG
Utp7 protein, length: 558 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13827
95 % 3 7 13669
90 % 3 7 13494
70 % 3 7 12792
50 % 3 7 11684
40 % 3 9 8738
30 % 3 9 7626
Entity #60 | Chains: CX
Enp1 protein, length: 480 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 6 16062
95 % 3 6 16941
90 % 3 6 16773
70 % 3 6 15581
50 % 3 6 14154
40 % 3 6 13152
30 % 4 15 5117
Entity #61 | Chains: CY
U3 small nucleolar ribonucleoprotein protein lcp5-like protein protein, length: 381 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 3 34424
95 % 2 3 26463
90 % 2 3 26181
70 % 2 3 23305
50 % 2 3 20485
40 % 2 3 19149
30 % 2 3 17174
Entity #62 | Chains: CZ
Bfr2 protein, length: 609 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 4 27677
95 % 2 4 21729
90 % 2 4 21200
70 % 2 4 19514
50 % 2 4 17379
40 % 2 4 16019
30 % 2 4 14492
Entity #63 | Chains: UP
Utp16 protein, length: 364 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 6 16132
95 % 3 6 13801
90 % 3 6 13621
70 % 3 6 12907
50 % 3 6 11792
40 % 3 6 11076
30 % 3 6 10218
Entity #7 | Chains: UJ
UTP10 protein, length: 1802 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 8 10579
95 % 3 8 11552
90 % 3 8 11428
70 % 3 8 10929
50 % 3 8 10065
40 % 3 8 9565
30 % 3 8 8858
Entity #8 | Chains: UK
U3 small nucleolar RNA-associated protein 11 protein, length: 270 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13428
95 % 3 7 12909
90 % 3 7 12729
70 % 3 7 12101
50 % 3 7 11038
40 % 3 7 10373
30 % 3 7 9592
Entity #9 | Chains: UL
Utp12 protein, length: 962 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 12842
95 % 3 7 13170
90 % 3 7 12658
70 % 3 7 12043
50 % 3 7 10984
40 % 3 11 7038
30 % 3 11 6609

Instructions

In the table for each entity, view a list of similar sequences by selecting the link associated with the percentage cutoff.



View more detailed documentation on the redundancy reduction and sequence clustering procedure used by RCSB PDB.

You can also use the structure comparison tool to compare any 2 given structures


ACTION - (A) Select for download / view details OR (B) Select two chains for comparison
Rank PDB ID Entity ID Chains Description Details Taxonomy EC Number
1 1SEI 1 A, B RIBOSOMAL PROTEIN S8 1422
2 4YBB 8 AH, BH 30S ribosomal protein S8 562
3 4Y4O 39 1h, 2h 30S ribosomal protein S8 274
4 5J8B 41 h 30S ribosomal protein S8 274
5 1AN7 1 A, B RIBOSOMAL PROTEIN S8 274
6 4W2F 8 AH, CH 30S Ribosomal Protein S8 274
7 6CFL 39 1h, 2h 30S Ribosomal Protein S8 274
8 6CAE 39 1h, 2h 30S ribosomal protein S8 274
9 4Y4P 39 1h, 2h 30S ribosomal protein S8 274
10 1I6U 2 A, B 30S RIBOSOMAL PROTEIN S8P 2190
11 5FDV 40 1h, 2h 30S ribosomal protein S8 274
12 5J4B 39 1h, 2h 30S ribosomal protein S8 274
13 4W2G 8 AH, CH 30S Ribosomal Protein S8 274
14 6CFK 39 1h, 2h 30S ribosomal protein S8 274
15 5J7L 8 AH, BH 30S ribosomal protein S8 562
16 5W4K 39 1h, 2h 30S ribosomal protein S8 274
17 4LFB 8 H ribosomal protein S8 274
18 1VY4 8 AH, CH 30S ribosomal protein S8 274
19 4WOI 8 AH, DH 30S ribosomal protein S8 562
20 5FDU 39 1h, 2h 30S ribosomal protein S8 274
21 6I7V 12 AH, BH 30S ribosomal protein S8 562
22 4W2I 8 AH, CH 30S Ribosomal Protein S8 274
23 5JC9 8 AH, BH 30S ribosomal protein S8 562
24 1VY5 8 AH, CH 30S ribosomal protein S8 274
25 5HCQ 39 1h, 2h 30S ribosomal protein S8 274
26 4WQF 41 BH, DH 30S ribosomal protein S8 274
27 6ND5 39 1h, 2h 30S ribosomal protein S8 274
28 4W2H 8 AH, CH 30S Ribosomal Protein S8 274
29 4WPO 41 BH, DH 30S ribosomal protein S8 274
30 5J8A 8 AH, BH 30S ribosomal protein S8 562
31 4V8I 8 AH, CH 30S Ribosomal Protein S8 274
32 4JI1 8 H RIBOSOMAL PROTEIN S8 274
33 4V88 24 AW, CW 40S ribosomal protein S22-A 4932
34 4Z3S 39 1h, 2h 30S ribosomal protein S8 274
35 5DOY 39 1h, 2h 30S Ribosomal Protein S8 274
36 5J5B 8 AH, BH 30S ribosomal protein S8 562
37 5HD1 39 1h, 2h 30S ribosomal protein S8 274
38 4U4R 24 D2, d2 40S ribosomal protein S22-A 4932
39 4DR6 8 H 30S ribosomal protein S8 274
40 4LF7 8 H ribosomal protein S8 274
41 4LF8 8 H ribosomal protein S8 274
42 5WIS 39 1h, 2h 30S ribosomal protein S8 274
43 4WSD 8 72, 7E 30S ribosomal protein S8 274
44 4WQU 41 BH, DH 30S ribosomal protein S8 274
45 5WIT 39 1h, 2h 30S ribosomal protein S8 274
46 5E81 8 72, 7E 30S ribosomal protein S8 274
47 2VQE 8 H 30S RIBOSOMAL PROTEIN S8 274
48 6GSJ 8 72, 7E 30S ribosomal protein S8 274
49 4U27 8 AH, CH 30S ribosomal protein S8 562
50 6OF1 39 1h, 2h 30S ribosomal protein S8 274
51 6CFJ 39 1h, 2h 30S ribosomal protein S8 274
52 4U3U 24 D2, d2 40S ribosomal protein S22-A 4932
53 4Z8C 39 1h, 2h 30S ribosomal protein S8 274
54 5HCR 39 1h, 2h 30S ribosomal protein S8 274
55 5TBW 71 X, d2 40S ribosomal protein S22-A 4932
56 2UUB 8 H 30S RIBOSOMAL PROTEIN S8 274
57 4DV6 8 H ribosomal protein S8 274
58 4JYA 8 H 30S ribosomal protein S8 274
59 5IBB 8 72, 7E 30S ribosomal protein S8 274
60 4DR5 8 H 30S ribosomal protein S8 274
61 5J4C 39 1h, 2h 30S ribosomal protein S8 274
62 4KHP 8 H 30S Ribosomal protein S8 274
63 4DR2 8 H 30S ribosomal protein S8 274
64 4WRO 12 7E 30S ribosomal protein S8 274
65 4WQ1 8 72, 7E 30S ribosomal protein S8 274
66 4LF9 8 H ribosomal protein S8 274
67 4WQY 41 BH, DH 30S ribosomal protein S8 274
68 4DUY 8 H ribosomal protein S8 274
69 4U3M 24 D2, d2 40S ribosomal protein S22-A 4932
70 4DV7 8 H ribosomal protein S8 274
71 4WRA 8 72, 7E 30S ribosomal protein S8 274
72 1S03 2 G, H 30S ribosomal protein S8 562
73 5IB7 8 72, 7E 30S ribosomal protein S8 274
74 4U26 8 AH, CH 30S ribosomal protein S8 562
75 4X64 8 H 30S ribosomal protein S8 274
76 5HCP 39 1h, 2h 30S ribosomal protein S8 274
77 5IT8 8 AH, BH 30S ribosomal protein S8 562
78 4V9D 8 AH, BH 30S ribosomal protein S8 562
79 4V9P 40 BH, DH, FH, HH 30S ribosomal protein S8 562
80 4V9H 21 AH 30S ribosomal protein S8 274
81 4U3N 24 D2, d2 40S ribosomal protein S22-A 4932
82 5J91 8 AH, BH 30S ribosomal protein S8 562
83 4V8D 8 AK, CK 30S RIBOSOMAL PROTEIN S8 274
84 5WNT 8 H RIBOSOMAL PROTEIN S8 274
85 4DR3 8 H 30S ribosomal protein S8 274
86 4V90 8 AH 30S RIBOSOMAL PROTEIN S8 274
87 4JI3 8 H RIBOSOMAL PROTEIN S8 274
88 4WQR 8 72, 7E 30S ribosomal protein S8 274
89 4JI6 8 H RIBOSOMAL PROTEIN S8 274
90 4JI8 8 H RIBOSOMAL PROTEIN S8 274
91 2UXC 8 H RIBOSOMAL PROTEIN S8 274
92 5IB8 8 72, 7E 30S ribosomal protein S8 274
93 4V9R 8 AH, CH 30S Ribosomal Protein S8 274
94 4B3M 8 H 30S RIBOSOMAL PROTEIN S8 274
95 5EL6 8 72, 7E 30S ribosomal protein S8 274
96 6O97 39 1h, 2h 30S ribosomal protein S8 274
97 5EL7 8 72, 7E 30S ribosomal protein S8 274
98 5VP2 39 1h, 2h 30S ribosomal protein S8 274
99 4U52 24 D2, d2 40S ribosomal protein S22-A 4932
100 4LF4 8 H ribosomal protein S8 274
101 5DFE 42 QH, XH 30S ribosomal protein S8 274
102 5NDK 50 72, 7E 30S ribosomal protein S8 274
103 4LF6 8 H ribosomal protein S8 274
104 4JI7 8 H RIBOSOMAL PROTEIN S8 274
105 5J88 8 AH, BH 30S ribosomal protein S8 562
106 4U24 8 AH, CH 30S ribosomal protein S8 562
107 4WU1 8 72, 7E 30S ribosomal protein S8 274
108 4U4Q 24 D2, d2 40S ribosomal protein S22-A 4932
109 6QNR 8 72, 7E 30S ribosomal protein S8 274
110 5EL4 8 72, 7E 30S ribosomal protein S8 274
111 5WNV 8 H 30S ribosomal protein S8 274
112 4U6F 24 D2, d2 40S ribosomal protein S22-A 4932
113 4B3T 8 H 30S RIBOSOMAL PROTEIN S8 274
114 4WR6 8 72, 7E 30S ribosomal protein S8 274
115 4V8B 8 AK, CK 30S RIBOSOMAL PROTEIN S8 274
116 5HAU 41 1h, 2h 30S ribosomal protein S8 274
117 4V9O 41 BH, DH, FH, HH 30S ribosomal protein S8 562
118 6MPF 8 H 30S ribosomal protein S8 274
119 2VQF 8 H 30S RIBOSOMAL PROTEIN S8 274
120 2UUA 8 H 30S RIBOSOMAL PROTEIN S8 274
121 4V87 38 BK, CK 30S RIBOSOMAL PROTEIN S8 274
122 4WF1 8 AH, CH 30S ribosomal protein S8 562
123 4U25 8 AH, CH 30S ribosomal protein S8 562
124 4V95 8 AH, CH 30S Ribosomal Protein S8 274
125 4WWW 39 QH, XH 30S ribosomal protein S8 562
126 4V7T 8 AH, CH 30S ribosomal protein S8 562
127 1VY7 8 AH, CH 30S ribosomal protein S8 274
128 4U4U 24 D2, d2 40S ribosomal protein S22-A 4932
129 5E7K 8 72, 7E 30S ribosomal protein S8 274
130 4U4Z 24 D2, d2 40S ribosomal protein S22-A 4932
131 5EL5 8 72, 7E 30S ribosomal protein S8 274
132 6FKR 39 1h, 2h 30S ribosomal protein S8 274
133 4B3R 8 H 30S RIBOSOMAL PROTEIN S8 274
134 4LNT 8 QH, XH 30S ribosomal protein S8 274
135 4U4Y 24 D2, d2 40S ribosomal protein S22-A 4932
136 4DR1 8 H 30S ribosomal protein S8 274
137 4LFA 8 H ribosomal protein S8 274
138 4U4N 24 D2, d2 40S ribosomal protein S22-A 4932
139 4DV4 8 H ribosomal protein S8 274
140 4U55 24 D2, d2 40S ribosomal protein S22-A 4932
141 4YZV 8 QH, XH 30S ribosomal protein S8 274
142 4JI0 8 H ribosomal protein S8 274
143 5IWA 7 H 30S ribosomal protein S8 274
144 4V7U 8 AH, CH 30S ribosomal protein S8 562
145 4V9S 8 AH, CH 30S Ribosomal Protein S8 274
146 4JI2 8 H RIBOSOMAL PROTEIN S8 274
147 4V6C 7 AH, CH 30S ribosomal protein S8 562
148 4JV5 8 H 30S ribosomal protein S8 274
149 4DR7 8 H 30S ribosomal protein S8 274
150 1J5E 8 H 30S RIBOSOMAL PROTEIN S8 274
151 4GKK 8 H 30S ribosomal protein S8 274
152 4DUZ 8 H ribosomal protein S8 274
153 5NDJ 50 72, 7E 30S ribosomal protein S8 274
154 4V7V 8 AH, CH 30S ribosomal protein S8 562
155 4X65 8 H 30S ribosomal protein S8 274
156 4V8G 8 AH, CH 30S Ribosomal Protein S8 274
157 4GKJ 8 H 30S ribosomal protein S8 274
158 4DV3 8 H ribosomal protein S8 274
159 4V7S 8 AH, CH 30S ribosomal protein S8 562
160 4DV5 8 H ribosomal protein S8 274
161 5DAT 24 D2 40S ribosomal protein S22-A 4932
162 5DAT 80 d2 40S ribosomal protein S22-A 4932
163 2UUC 8 H 30S RIBOSOMAL PROTEIN S8 274
164 4LFC 8 H ribosomal protein S8 274
165 1FJG 9 H 30S RIBOSOMAL PROTEIN S8 274
166 3T1Y 8 H 30S ribosomal protein S8 274
167 4WZO 8 72, 7E 30S ribosomal protein S8 274
168 4JI4 8 H RIBOSOMAL PROTEIN S8 274
169 1VY6 8 AH, CH 30S ribosomal protein S8 274
170 1XMQ 10 H 30S Ribosomal Protein S8 274
171 5WNP 8 H 30S ribosomal protein S8 274
172 6CAP 8 H 30S ribosomal protein S8 274
173 4U20 8 AH, CH 30S ribosomal protein S8 562
174 6MPI 8 H 30S ribosomal protein S8 274
175 5I4L 24 D2, d2 40S ribosomal protein S22-A 4932
176 4DV0 8 H ribosomal protein S8 274
177 4V9B 8 AK, CK 30S RIBOSOMAL PROTEIN S8 274
178 4U1V 8 AH, CH 30S ribosomal protein S8 562
179 4V6F 38 BK, CK 30S ribosomal protein S8 274
180 4X62 8 H 30S ribosomal protein S8 274
181 4V8F 38 BK, CK 30S RIBOSOMAL PROTEIN S8 274
182 4U51 24 D2, d2 40S ribosomal protein S22-A 4932
183 4B3S 8 H 30S RIBOSOMAL PROTEIN S8 274
184 4DV2 8 H ribosomal protein S8 274
185 4DV1 8 H ribosomal protein S8 274
186 5WNU 8 H 30S ribosomal protein S8 274
187 1N32 10 H 30S RIBOSOMAL PROTEIN S8 274
188 5F8K 39 1h, 2h 30S ribosomal protein S8 274
189 1I94 8 H 30S RIBOSOMAL PROTEIN S8 274
190 6HHQ 70 X, d2 40S ribosomal protein S22-A 4932
191 4V8H 8 AH, CH 30S Ribosomal Protein S8 274
192 5OBM 68 D2, d2 40S ribosomal protein S22-A 4932
193 4JI5 8 H RIBOSOMAL PROTEIN S8 274
194 6CAQ 8 H 30S ribosomal protein S8 274
195 4K0K 8 H 30S ribosomal protein S8 274
196 4W2E 41 h 30S ribosomal protein S8 274
197 4V8C 38 CK, DK 30S RIBOSOMAL PROTEIN S8 274
198 5BR8 8 H 30S ribosomal protein S8 274
199 4LF5 8 H ribosomal protein S8 274
200 5J4D 42 QA, VC 30S ribosomal protein S8 274
201 4V9A 8 AK, CK 30S RIBOSOMAL PROTEIN S8 274
202 4U53 24 D2, d2 40S ribosomal protein S22-A 4932
203 5ON6 72 X, d2 40S ribosomal protein S22-A 4932
204 4V5J 8 AH, CH 30S RIBOSOMAL PROTEIN S8 274
205 4U50 24 D2, d2 40S ribosomal protein S22-A 4932
206 5NDV 68 D2, d2 40S ribosomal protein S22-A 4932
207 5LYB 24 D2, d2 40S ribosomal protein S22-A 4932
208 6ND6 39 1h, 2h 30S ribosomal protein S8 274
209 4V7Y 8 AH, CH 30S ribosomal protein S8 274
210 6UO1 39 1h, 2h 30S ribosomal protein S8 274
211 6GSK 8 72, 7E 30S ribosomal protein S8 274
212 4V9C 8 AH, CH 30S ribosomal protein S8 562
213 4V8E 38 BK, DK 30S RIBOSOMAL PROTEIN S8 274
214 5J30 39 QH, XH 30S ribosomal protein S8 274
215 6QNQ 8 72, 7E 30S ribosomal protein S8 274
216 4DR4 8 H 30S ribosomal protein S8 274
217 4WZD 8 72, 7E 30S ribosomal protein S8 274
218 3OTO 8 H 30S RIBOSOMAL PROTEIN S8 274
219 4X66 8 H 30S ribosomal protein S8 274
220 2UU9 8 H 30S RIBOSOMAL PROTEIN S8 274
221 4V8Q 42 BH 30S RIBOSOMAL PROTEIN S8 274
222 4U56 24 D2, d2 40S ribosomal protein S22-A 4932
223 4V85 8 AH 30S ribosomal protein S8 562
224 1HR0 9 H 30S RIBOSOMAL PROTEIN S8 274
225 4AQY 8 H 30S RIBOSOMAL PROTEIN S8 274
226 4W4G 8 QH, XH 30S ribosomal protein S8 274
227 4NXM 8 H ribosomal protein S8 274
228 4V5L 8 AH 30S RIBOSOMAL PROTEIN S8 274
229 4YPB 8 QH, XH 30S ribosomal protein S8 274
230 4V7X 8 AH, CH 30S ribosomal protein S8 274
231 5TGA 24 D2, d2 40S ribosomal protein S22-A 4932
232 4U1U 8 AH, CH 30S ribosomal protein S8 562
233 4ZER 39 1h, 2h 30S ribosomal protein S8 274
234 1IBL 11 H 30S RIBOSOMAL PROTEIN S8 274
235 5MEI 71 X, d2 40S ribosomal protein S22-A 4932
236 4V7W 8 AH, CH 30S ribosomal protein S8 274
237 4WT1 8 72, 7E 30S ribosomal protein S8 274
238 6C5L 8 AH, CH 30S ribosomal protein S8 274
239 4WT8 8 AH, BH 30S ribosomal protein S8 274
240 5DOX 39 1h, 2h 30S ribosomal protein S8 274
241 6OTR 8 QH, XH 30S ribosomal protein S8 274
242 4NXN 8 H ribosomal protein S8 274
243 1XNR 10 H 16S Ribosomal protein S8 274
244 4LT8 8 QH, XH 30S ribosomal protein S8 274
245 5FCJ 24 D2, d2 40S ribosomal protein S22-A 4932
246 5WNQ 8 H 30S ribosomal protein S8 274
247 4U4O 24 D2, d2 40S ribosomal protein S22-A 4932
248 6MKN 8 H 30S ribosomal protein S8 274
249 4V51 8 AH, CH 30S RIBOSOMAL PROTEIN S8 274
250 6DTI 8 H 30S ribosomal protein S8 274
251 4V7L 8 AH, CH 30S ribosomal protein S8 274
252 4V5R 8 AH, CH 30S RIBOSOMAL PROTEIN S8 274
253 1HNZ 9 H 30S RIBOSOMAL PROTEIN S8 274
254 1XNQ 10 H Ribosomal protein S8 274
255 4V8A 38 CH, DH 30S ribosomal protein S8 274
256 4V5K 8 AH, CH 30S RIBOSOMAL PROTEIN S8 274
257 4V5Q 8 AH, CH 30S RIBOSOMAL PROTEIN S8 274
258 4V7J 7 Ah, Bh 30S ribosomal protein S8 274
259 5DGV 24 D2, d2 40S ribosomal protein S22-A 4932
260 6BZ6 8 QH, XH 30S ribosomal protein S8 274
261 5DGE 24 D2, d2 40S ribosomal protein S22-A 4932
262 5J3C 39 QH, XH 30S ribosomal protein S8 274
263 4V5C 8 AH, CH 30S RIBOSOMAL PROTEIN S8 274
264 4V5E 8 AH, CH 30S RIBOSOMAL PROTEIN S8 274
265 4L47 8 QH, XH 30S ribosomal protein S8 274
266 4V5P 8 AH, CH 30S RIBOSOMAL PROTEIN S8 274
267 5V8I 39 1h, 2h 30S ribosomal protein S8 274
268 4ZSN 8 QH, XH 30S ribosomal protein S8 274
269 4V5D 8 AH, CH 30S RIBOSOMAL PROTEIN S8 274
270 5NDW 17 D2, d2 40S ribosomal protein S22-A 4932
271 6CZR 39 1h, 2h 30S ribosomal protein S8 274
272 6OXA 8 QH, XH 30S ribosomal protein S8 274
273 6BUW 8 QH, XH 30S ribosomal protein S8 274
274 4V7Z 8 AH, CH 30S ribosomal protein S8 274
275 4V8X 8 AH, CH 30S RIBOSOMAL PROTEIN S8 274
276 4V5S 8 AH, CH 30S RIBOSOMAL PROTEIN S8 274
277 4V9I 8 AH, CH 30S Ribosomal protein S8 274
278 1XMO 10 H 30S ribosomal protein S8 274
279 3T1H 8 H 30S ribosomal protein S8 274
280 2UXD 8 H RIBOSOMAL PROTEIN S8 274
281 1N33 10 H 30S RIBOSOMAL PROTEIN S8 274
282 1IBK 9 H 30S RIBOSOMAL PROTEIN S8 274
283 4V6G 8 AK, CK 30S RIBOSOMAL PROTEIN S8 274
284 4V8N 8 AH, CH 30S RIBOSOMAL PROTEIN S8 274
285 4V97 8 AH, CH 30S ribosomal protein S8 274
286 6CAR 8 H 30S ribosomal protein S8 274
287 1HNW 9 H 30S RIBOSOMAL PROTEIN S8 274
288 4V7M 8 AH, CH 30S ribosomal protein S8 274
289 4WSM 8 72, 7E 30S ribosomal protein S8 274
290 4TUD 8 QH, XH 30S ribosomal protein S8 274
291 1IBM 11 H 30S RIBOSOMAL PROTEIN S8 274
292 5WNR 8 H 30S ribosomal protein S8 274
293 6CAO 8 H 30S ribosomal protein S8 274
294 4V6A 8 AH, CH 30S ribosomal protein S8 274
295 4TUE 8 QH, XH 30S ribosomal protein S8 274
296 6OXI 8 QH, XH 30S ribosomal protein S8 274
297 4TUA 8 QH, XH 30S ribosomal protein S8 274
298 4BTS 18 AH, BH, CH, DH 40S RIBOSOMAL PROTEIN RPS22E 5911
299 4V84 8 AH, CH 30S ribosomal protein S8 274
300 5WNS 8 H 30S ribosomal protein S8 274
301 6NDK 8 QH, XH 30S ribosomal protein S8 274
302 4V7K 7 Ah, Bh 30S ribosomal protein S8 274
303 4YY3 8 H 30S ribosomal protein S8 274
304 1HNX 9 H 30S RIBOSOMAL PROTEIN S8 274
305 4V9Q 38 BH, DH 30S ribosomal protein S8 274
306 6BZ8 8 QH, XH 30S ribosomal protein S8 274
307 4TUC 8 QH, XH 30S ribosomal protein S8 274
308 4YHH 8 H 30S ribosomal protein S8 274
309 5VPO 9 QH, XH 30S ribosomal protein S8 274
310 6NY6 8 H 30S ribosomal protein S8 274
311 5NDG 24 D2, d2 40S ribosomal protein S22-A 4932
312 4TUB 8 QH, XH 30S ribosomal protein S8 274
313 4V9N 11 AH, CH 30S ribosomal protein S8 274
314 5FCI 24 D2, d2 40S ribosomal protein S22-A 4932
315 4P70 8 QH, XH 30S ribosomal protein S8 274
316 4V8U 8 AH, CH 30S RIBOSOMAL PROTEIN S8 274
317 4LSK 8 QH, XH 30S ribosomal protein S8 274
318 5DC3 24 D2, d2 40S ribosomal protein S22-A 4932
319 4V6D 7 AH, CH 30S ribosomal protein S8 562
320 4P6F 8 QH, XH 30S ribosomal protein S8 274
321 4V67 10 AH, CH 30S ribosomal protein S8 274
322 4V83 8 AH, CH 30S ribosomal protein S8 274
323 5DGF 24 D2, d2 40S ribosomal protein S22-A 4932
324 4V5F 8 AH, CH 30S RIBOSOMAL PROTEIN S8 274
325 4V5O 17 AH, BH RIBOSOMAL PROTEIN S8 CONTAINING PROTEIN 5911
326 1VVJ 8 QH, XH 30S ribosomal protein S8 274
327 4LFZ 8 QH, XH 30S ribosomal protein S8 274
328 2E5L 9 H 30S ribosomal protein S8 274
329 6BZ7 8 QH, XH 30S ribosomal protein S8 274
330 6N1D 42 AS08, BS08 30S ribosomal protein S8 274
331 4V6E 7 AH, CH 30S ribosomal protein S8 562
332 6UCQ 38 1h, 2h 30S ribosomal protein S8 274
333 6CAS 8 H 30S ribosomal protein S8 274
334 4V52 7 AH, CH 30S ribosomal protein S8 562
335 5CZP 39 QH, XH 30S ribosomal protein S8 274
336 6N9F 39 1h, 2h 30S Ribosomal Protein S8 274
337 6N9E 39 1h, 2h 30S Ribosomal Protein S8 274
338 2HHH 8 H 30S ribosomal protein S8 274
339 4V89 8 AH 30S ribosomal protein S8 562
340 4OX9 8 H 30S ribosomal protein S8 274
341 4V54 7 AH, CH 30S ribosomal protein S8 562
342 2UXB 8 H RIBOSOMAL PROTEIN S8 274
343 1I96 8 H 30S RIBOSOMAL PROTEIN S8 274
344 5TGM 24 D2, d2 40S ribosomal protein S22-A 4932
345 4V9K 7 AH, CH 30S ribosomal protein S8 274
346 4V50 10 AH, CH 30S ribosomal protein S8 562
347 1N34 9 H 30S RIBOSOMAL PROTEIN S8 274
348 4V57 7 AH, CH 30S ribosomal protein S8 562
349 4V5A 8 AH, CH 30S RIBOSOMAL PROTEIN S8 274
350 4V63 10 AH, CH 30S ribosomal protein S8 274
351 4L71 8 QH, XH 30S ribosomal protein S8 274
352 4KVB 8 H 30S ribosomal protein S8 274
353 4XEJ 35 AS08, BS08 30S ribosomal protein S8 274
354 4V64 7 AH, CH 30S ribosomal protein S8 562
355 4V7P 8 AH, DH 30S ribosomal protein S8 274
356 4V8J 8 AH, CH 30S ribosomal protein S8 274
357 1N36 8 H 30S RIBOSOMAL PROTEIN S8 274
358 2ZM6 8 H 30S ribosomal protein S8 274
359 4V4H 7 AH, CH 30S RIBOSOMAL PROTEIN S8 562
360 4V4Q 7 AH, CH 30S ribosomal protein S8 562
361 4V5B 40 BH, DH 30S RIBOSOMAL PROTEIN S8 RESIDUES 2-130 562
362 5D8B 35 EC, IA 30S ribosomal protein S8 274
363 6BY1 43 AH, BH 30S ribosomal protein S8 562
364 4LEL 8 QH, XH 30S ribosomal protein S8 274
365 4V53 7 AH, CH 30S ribosomal protein S8 562
366 2F4V 9 H 30S ribosomal protein S8 274
367 4V9L 7 AH, CH 30S ribosomal protein S8 274
368 1FKA 8 H 30S RIBOSOMAL PROTEIN S8 274
369 4V5G 8 AH, CH 30S RIBOSOMAL PROTEIN S8 274
370 4V56 7 AH, CH 30S ribosomal protein S8 562
371 1I97 8 H 30S RIBOSOMAL PROTEIN S8 274
372 4V9J 7 AH, CH 30S ribosomal protein S8 274
373 4V55 7 AH, CH 30S ribosomal protein S8 562
374 1I95 8 H 30S RIBOSOMAL PROTEIN S8 274
375 4V8O 8 AH 30S RIBOSOMAL PROTEIN S8 274
376 4V7R 16 AO, CO 40S ribosomal protein S22-A 4932
377 4V9M 7 AH, CH 30S ribosomal protein S8 274
378 4W29 7 AH, CH 30S ribosomal protein S8 274
379 4V5Y 7 AH, CH 30S ribosomal protein S8 562
380 4V4Y 10 AK 30S ribosomal protein S8 274
381 4V4J 41 i 30S ribosomal protein S8 274
382 4V4X 10 AK 30S ribosomal protein S8 274
383 4V4Z 11 AK 30S ribosomal protein S8 274
384 4V4I 41 i 30S ribosomal protein S8 274
385 4V4P 43 BK 30S ribosomal protein S8 274
386 5VYC 16 W1, W2, W3, W4, W5, W6 40S ribosomal protein S15a 9606
387 4V4R 11 AH 30S ribosomal protein S8 274
388 4V4S 11 AH 30S ribosomal protein S8 274
389 4V4T 11 AH 30S ribosomal protein S8 274
390 4KZZ 23 W 40S Ribosomal Protein S15A 9986
391 4KZX 23 W 40S ribosomal protein S15A 9986
392 4KZY 23 W 40S Ribosomal Protein S15A 9986
393 4V49 10 AH 30S ribosomal protein S8 562
394 4V4A 8 AH 30S ribosomal protein S8 562
395 4V4G 8 AH, CH, EH, GH, IH 30S ribosomal protein S8 562
396 6Y7C 22 W 40S ribosomal protein S22-A 4932
397 6TMF 10 J 30S ribosomal protein S8 2264
398 6V39 38 h 30S ribosomal protein S8 470
399 6V3A 38 h 30S ribosomal protein S8 470
400 6V3B 38 h 30S ribosomal protein S8 470
401 6V3E 8 h 30S ribosomal protein S8 470
402 6UZ7 70 W 40S ribosomal protein S22 28985
403 6TC3 8 S081 30S ribosomal protein S8 562
404 6TBV 8 S081 30S ribosomal protein S8 562
405 6T83 24 Wb, x 40S ribosomal protein S22-A 4932
406 6T7T 26 SW 40S ribosomal protein S22-A 4932
407 6T7I 24 SW 40S ribosomal protein S22-A 4932
408 6T4Q 23 SW 40S ribosomal protein S22-A 4932
409 6SZS 39 h 30S ribosomal protein S8 562
410 6SW9 10 I 30S ribosomal protein S8 29292
411 6SWC 10 I 30S ribosomal protein S8 29292
412 6SWD 9 I 30S ribosomal protein S8 29292
413 6SV4 41 b, bb, bc 40S ribosomal protein S22-A 4932
414 6SPC 8 h 30S ribosomal protein S8 287
415 6SPE 8 h 30S ribosomal protein S8 287
416 6SPF 40 h 30S ribosomal protein S8 287
417 6SPG 8 h 30S ribosomal protein S8 287
418 6SNT 24 W 40S ribosomal protein S22-A 4932
419 6SGC 24 X1 Ribosomal protein S15a 9986
420 6S47 68 BX 40S ribosomal protein S22-A TRSSVLADALNAINNAEKTGKRQVLIRPSSKVIIKFLQVMQKHGYIGEFEYIDDHRSGK IVVQLNGRLNKCGVISPRFNVKIGDIEKWTANLLPARQFGYVILTTSAGIMDHEEARRKH VSGKILGFVY 4932
421 6S0X 38 h 30S ribosomal protein S8 1280
422 6S13 38 h 30S ribosomal protein S8 1280
423 6RXT 41 Cm 40S ribosomal protein S22-like protein 209285
424 6RXU 45 Cm 40S ribosomal protein S22-like protein 209285
425 6RXV 45 Cm 40S ribosomal protein S22-like protein 209285
426 6RXX 26 Cm 40S ribosomal protein S22-like protein 209285
427 6RXY 40 Cm 40S ribosomal protein S22-like protein 209285
428 6RXZ 44 Cm 40S ribosomal protein S22-like protein 209285
429 6P5I 24 X uS8 9986
430 6P5J 24 X uS8 9986
431 6P5K 70 X uS8 9986
432 6P5N 70 X uS8 9986
433 6P4G 24 X uS8 9986
434 6P4H 25 X uS8 9986
435 6OUO 40 m 30S ribosomal protein S8 562
436 6RM3 69 SW0 uS8 6039
437 6OSQ 41 m 30S ribosomal protein S8 562
438 6OST 38 m 30S ribosomal protein S8 562
439 6OT3 40 m 30S ribosomal protein S8 562
440 6OSK 40 m 30S ribosomal protein S8 562
441 6ORE 42 m 30S ribosomal protein S8 562
442 6ORL 38 m 30S ribosomal protein S8 562
443 6OM7 29 SW 40S ribosomal protein S15a 9606
444 6OLZ 69 BW 40S ribosomal protein S15a 9606
445 6OM0 29 SW 40S ribosomal protein S15a 9606
446 6OLE 29 SW 40S ribosomal protein S15a 9606
447 6OLF 29 SW 40S ribosomal protein S15a 9606
448 6OLG 72 BW 40S ribosomal protein S15a 9606
449 6OLI 29 SW 40S ribosomal protein S15a 9606
450 6OKK 11 K 40S ribosomal protein S15A 5833
451 6RBD 15 W 40S ribosomal protein S22-A 4932
452 6RBE 15 W 40S ribosomal protein S22-A 4932
453 6OGF 35 M 30S ribosomal protein S8 562
454 6OGG 35 M 30S ribosomal protein S8 562
455 6OGI 35 M 30S ribosomal protein S8 562
456 6OFX 35 M 30S ribosomal protein S8 562
457 6OG7 35 M 30S ribosomal protein S8 562
458 6R7Q 82 TT Ribosomal protein S15a 9986
459 6R6G 50 TT Ribosomal protein S15a 9986
460 6R6P 66 TT Ribosomal protein S15a 9986
461 6R5Q 74 TT Ribosomal protein S15a 9986
462 6O9J 38 h 30S ribosomal protein S8 562
463 6O9K 8 h 30S ribosomal protein S8 562
464 6QZP 76 SW 40S ribosomal protein S15a 9606
465 6O7K 22 p 30S ribosomal protein S8 562
466 6NQB 9 H 30S ribosomal protein S8 562
467 6Q95 8 m 30S ribosomal protein S8 274
468 6Q97 45 m 30S ribosomal protein S8 562
469 6Q98 43 m 30S ribosomal protein S8 562
470 6Q9A 43 m 30S ribosomal protein S8 562
471 6Q8Y 27 b 40S ribosomal protein S22-A 4932
472 6I7O 41 b, bb 40S ribosomal protein S22-A 4932
473 6IP5 75 3M 40S ribosomal protein S15a 9606
474 6IP6 74 3M 40S ribosomal protein S15a 9606
475 6IP8 74 3M 40S ribosomal protein S15a 9606
476 6MTB 73 WW 40S ribosomal protein S15a 9986
477 6MTC 72 WW 40S ribosomal protein S15a 9986
478 6MTD 74 WW uS8 9986
479 6MTE 73 WW uS8 9986
480 6HTQ 37 h 30S ribosomal protein S8 1423
481 6HRM 40 m 30S ribosomal protein S8 562
482 6HCQ 27 X2 Ribosomal protein S15a 9986
483 6HCJ 27 X2 Ribosomal protein S15a 9986
484 6HCM 24 X1 Ribosomal protein S15a 9986
485 6HCF 24 X1 Ribosomal protein S15a 9986
486 6HA1 38 h 30S ribosomal protein S8 1423
487 6HA8 40 h 30S ribosomal protein S8 1423
488 6H58 39 h, hh 30S ribosomal protein S8 562
489 6H4N 8 h 30S ribosomal protein S8 562
490 6DZI 8 q 30S ribosomal protein S8 1772
491 6DZK 8 H 30S ribosomal protein S8 1772
492 6GZX 38 H3, H4 30S ribosomal protein S8 274
493 6GZZ 38 H3, H4 30S ribosomal protein S8 274
494 6GZQ 38 H2 30S ribosomal protein S8 274
495 6GZ3 33 BW Ribosomal protein S15a 9986
496 6GZ4 36 BW ribosomal protein uS8 9986
497 6GZ5 33 BW ribosomal protein uS8 9986
498 6GXM 41 h 30S ribosomal protein S8 562
499 6GXN 41 h 30S ribosomal protein S8 562
500 6GXO 41 h 30S ribosomal protein S8 562
501 6GXP 40 h 30S ribosomal protein S8 562
502 6GWT 41 h 30S ribosomal protein S8 562
503 6GSL 8 72, 7E 30S ribosomal protein S8 274
504 6GSM 26 W 40S ribosomal protein S22 28985
505 6GSN 40 W 40S ribosomal protein S22 28985
506 6GQV 70 AM 40S ribosomal protein S22-A 4932
507 6GQ1 70 AM 40S ribosomal protein S22-A 4932
508 6GQB 70 AM 40S ribosomal protein S22-A 4932
509 6DNC 45 UA 30S ribosomal protein S8 562
510 6D9J 72 XX uS8 9986
511 6D90 73 XX uS8 9986
512 5ZLU 15 N 30S ribosomal protein S8 274
513 6G5H 14 W 40S ribosomal protein S15a 9606
514 6G5I 24 W 40S ribosomal protein S15a 9606
515 6G4S 19 W 40S ribosomal protein S15a 9606
516 6G4W 16 W 40S ribosomal protein S15a 9606
517 6G51 15 W 40S ribosomal protein S15a 9606
518 6G53 15 W 40S ribosomal protein S15a 9606
519 6G18 25 W 40S ribosomal protein S15a 9606
520 6FYX 26 W 40S ribosomal protein S22 28985
521 6FYY 26 W 40S ribosomal protein S22 28985
522 6FXC 8 Ah, Bh 30S ribosomal protein S8 1280
523 5ZEU 5 h 30S ribosomal protein S8 1772
524 5ZEB 5 h 30S ribosomal protein S8 1772
525 5ZEP 5 h 30S ribosomal protein S8 1772
526 6C4I 41 h 30S ribosomal protein S8 562
527 6FEC 29 a 40S ribosomal protein S15a 9606
528 6FAI 33 W 40S ribosomal protein S22-A 4932
529 6BU8 38 H 30S ribosomal protein S8 562
530 6BOH 42 RA, WC 30S ribosomal protein S8 274
531 6BOK 41 PA, SC 30S ribosomal protein S8 274
532 6ERI 41 BH 30S ribosomal protein S8, chloroplastic 3562
533 6ENU 8 h 30S ribosomal protein S8 562
534 6ENJ 38 h 30S ribosomal protein S8 562
535 6ENF 8 h 30S ribosomal protein S8 562
536 6EML 24 b 40S ribosomal protein S22-A 4932
537 6B4V 42 QA, UC 30S ribosomal protein S8 274
538 6EK0 76 SW 40S ribosomal protein S15a 9606
539 6AZ1 10 J ribosomal protein S8 5661
540 6AWB 13 K 30S ribosomal protein S8 562
541 6AWC 13 K 30S ribosomal protein S8 562
542 6AWD 12 K 30S ribosomal protein S8 562
543 5OT7 14 G 30S ribosomal protein S8 274
544 5OQL 45 w 40S ribosomal protein S22-like protein 209285
545 5OPT 22 e 40S ribosomal protein S15a, putative 5693
546 5WLC 13 LE rpS22_uS8 4932
547 5WFK 41 h 30S ribosomal protein S8 562
548 5WFS 41 h 30S ribosomal protein S8 562
549 5WF0 41 h 30S ribosomal protein S8