6RXV

Cryo-EM structure of the 90S pre-ribosome (Kre33-Noc4) from Chaetomium thermophilum, state B2


Sequence Similarity Clusters for the Entities in PDB 6RXV

Entity #1 | Chains: UA
Periodic tryptophan protein 2-like protein protein, length: 904 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13440
95 % 3 7 13263
90 % 3 7 13078
70 % 3 7 12428
50 % 3 11 7367
40 % 3 11 7117
30 % 3 11 6681
Entity #10 | Chains: UM
Utp13 protein, length: 912 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 12779
95 % 3 7 13038
90 % 3 7 12852
70 % 3 7 12212
50 % 3 7 11162
40 % 3 7 10515
30 % 3 7 9725
Entity #11 | Chains: UN
Utp14 protein, length: 938 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13143
95 % 3 7 12337
90 % 3 7 12384
70 % 3 7 11787
50 % 3 7 10760
40 % 3 7 10133
30 % 3 7 9213
Entity #12 | Chains: UO
Utp15 protein, length: 557 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 12780
95 % 3 7 13039
90 % 3 7 12853
70 % 3 7 12213
50 % 3 7 11163
40 % 3 7 10516
30 % 3 9 7685
Entity #13 | Chains: UQ
Utp17 protein, length: 960 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 12489
95 % 3 7 12301
90 % 3 7 13119
70 % 3 7 11537
50 % 3 7 10535
40 % 3 7 9924
30 % 3 7 9197
Entity #14 | Chains: UR
Utp18 protein, length: 618 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 12995
95 % 3 7 12438
90 % 3 7 12270
70 % 3 7 11685
50 % 3 7 10666
40 % 3 7 10044
30 % 3 11 6468
Entity #15 | Chains: UU
Utp21 protein, length: 1049 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 12925
95 % 3 7 12300
90 % 3 7 12117
70 % 3 7 11536
50 % 3 7 10534
40 % 3 7 9923
30 % 3 7 9196
Entity #16 | Chains: UX
Utp24 protein, length: 193 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 8 11993
95 % 3 8 10562
90 % 3 8 11189
70 % 3 8 10816
50 % 3 12 6772
40 % 3 12 6082
30 % 3 12 6002
Entity #17 | Chains: UZ
Utp30 protein, length: 391 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 12395
95 % 3 7 12315
90 % 3 7 12133
70 % 3 7 11559
50 % 3 7 10553
40 % 3 7 9941
30 % 3 7 9214
Entity #18 | Chains: CA,CB
Nop1 protein, length: 313 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 5352
95 % 3 7 6145
90 % 3 7 6171
70 % 3 7 6092
50 % 3 11 3459
40 % 3 11 3447
30 % 3 11 3375
Entity #19 | Chains: CC
Nop56 protein, length: 523 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13231
95 % 3 7 12876
90 % 3 7 12709
70 % 3 7 12079
50 % 3 11 7370
40 % 3 15 5279
30 % 3 15 5054
Entity #2 | Chains: UB
Utp2 protein, length: 907 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 12947
95 % 3 7 12786
90 % 3 7 12172
70 % 3 7 11600
50 % 3 7 10588
40 % 3 7 9969
30 % 3 7 9238
Entity #20 | Chains: CD
Nop58 protein, length: 582 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 12755
95 % 3 7 12533
90 % 3 7 13009
70 % 3 7 11772
50 % 3 7 11125
40 % 3 7 10488
30 % 3 7 9697
Entity #21 | Chains: CE,CF
Snu13 protein, length: 127 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 5351
95 % 3 7 6144
90 % 3 7 6170
70 % 3 7 6091
50 % 12 34 1326
40 % 13 35 1306
30 % 12 34 1398
Entity #22 | Chains: CG
Rrp9 protein, length: 630 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13419
95 % 3 7 13230
90 % 3 7 13046
70 % 3 7 12397
50 % 3 7 11332
40 % 3 7 10664
30 % 3 7 9861
Entity #23 | Chains: CH
RNA 3'-terminal phosphate cyclase-like protein protein, length: 411 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13273
95 % 3 7 12953
90 % 3 7 12780
70 % 3 7 12137
50 % 3 7 11094
40 % 3 7 10460
30 % 3 7 9671
Entity #24 | Chains: CI
Bms1 protein, length: 1163 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 12756
95 % 3 7 12997
90 % 3 7 12810
70 % 3 7 12173
50 % 3 7 11126
40 % 3 11 7111
30 % 3 11 6675
Entity #25 | Chains: CJ
Imp3 protein, length: 183 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 8 10166
95 % 3 8 11078
90 % 3 8 10914
70 % 3 8 10566
50 % 3 12 6582
40 % 3 12 6373
30 % 3 12 6040
Entity #26 | Chains: CK
Imp4 protein, length: 297 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 8 10028
95 % 3 8 10843
90 % 3 8 10701
70 % 3 8 10352
50 % 3 11 7357
40 % 3 11 7107
30 % 3 11 6673
Entity #27 | Chains: CL
Mpp10 protein, length: 785 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 12405
95 % 3 7 12952
90 % 3 7 12284
70 % 3 7 11539
50 % 3 7 11093
40 % 3 7 10459
30 % 3 7 9670
Entity #28 | Chains: CM
Sof1 protein, length: 446 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13274
95 % 3 7 12331
90 % 3 7 12781
70 % 3 7 11577
50 % 3 7 11095
40 % 3 9 7972
30 % 3 9 7456
Entity #29 | Chains: CN,CO
Emg1 protein, length: 252 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 5105
95 % 3 7 6096
90 % 3 7 5738
70 % 8 17 2249
50 % 8 17 2337
40 % 8 17 2367
30 % 8 17 2358
Entity #3 | Chains: UC
Utp3 protein, length: 648 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13414
95 % 3 7 13222
90 % 3 7 13040
70 % 3 7 12389
50 % 3 7 11323
40 % 3 7 10655
30 % 3 7 9855
Entity #30 | Chains: CP
KRR1 small subunit processome component protein, length: 322 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 8 9176
95 % 3 8 9365
90 % 3 8 9699
70 % 3 11 7395
50 % 3 11 6809
40 % 3 11 6586
30 % 3 11 5868
Entity #31 | Chains: CQ
Pre-rRNA-processing protein PNO1 protein, length: 259 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13068
95 % 3 7 12587
90 % 3 7 12411
70 % 3 7 11814
50 % 3 7 11245
40 % 3 7 10588
30 % 3 7 9790
Entity #32 | Chains: CR,CS
Kre33 protein, length: 1073 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 8 4334
95 % 3 8 4972
90 % 3 8 5197
70 % 3 8 4980
50 % 3 8 5043
40 % 3 8 4918
30 % 3 8 4742
Entity #33 | Chains: CT
Fcf2 protein, length: 203 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 12820
95 % 3 7 13142
90 % 3 7 12958
70 % 3 7 12316
50 % 3 7 11254
40 % 3 7 10596
30 % 3 7 9798
Entity #34 | Chains: Ca
40S ribosomal protein S1 protein, length: 255 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 5 17717
95 % 3 5 16618
90 % 3 5 16325
70 % 41 81 488
50 % 46 137 360
40 % 48 144 349
30 % 48 144 365
Entity #35 | Chains: Cb
40S ribosomal protein S4 protein, length: 264 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 5 18120
95 % 2 5 17272
90 % 2 5 16943
70 % 45 163 264
50 % 47 173 263
40 % 47 177 266
30 % 47 182 270
Entity #36 | Chains: Cc
40S ribosomal protein s5-like protein protein, length: 212 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13406
95 % 3 7 13215
90 % 3 7 13034
70 % 8 93 624
50 % 49 183 230
40 % 49 183 243
30 % 49 183 258
Entity #37 | Chains: Cd
40S ribosomal protein S6 protein, length: 239 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 5 17751
95 % 2 5 16617
90 % 2 5 16324
70 % 7 83 707
50 % 46 164 305
40 % 46 169 303
30 % 46 169 323
Entity #38 | Chains: Ce
40S ribosomal protein S7 protein, length: 203 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13408
95 % 3 7 13217
90 % 3 7 13035
70 % 3 7 12382
50 % 46 170 287
40 % 46 170 297
30 % 48 173 299
Entity #39 | Chains: Cf
40S ribosomal protein S8 protein, length: 202 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 5 18119
95 % 2 5 17270
90 % 2 5 16942
70 % 40 83 475
50 % 47 172 267
40 % 47 176 268
30 % 47 176 286
Entity #4 | Chains: UD
Utp4 protein, length: 884 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 4 8 8833
95 % 4 8 9606
90 % 4 8 9184
70 % 4 8 8925
50 % 4 8 8289
40 % 4 8 7982
30 % 4 8 7469
Entity #40 | Chains: Cg
40S ribosomal protein s9-like protein protein, length: 190 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 12532
95 % 3 7 12568
90 % 3 7 12392
70 % 47 167 255
50 % 49 182 234
40 % 49 186 240
30 % 49 186 252
Entity #41 | Chains: Ch
40S ribosomal protein S13-like protein protein, length: 151 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 12711
95 % 3 7 12895
90 % 3 7 12728
70 % 47 172 249
50 % 49 179 244
40 % 49 184 242
30 % 49 184 254
Entity #42 | Chains: Ci
40S ribosomal protein S14-like protein protein, length: 150 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13251
95 % 3 7 12908
90 % 7 73 788
70 % 49 180 226
50 % 49 181 236
40 % 49 181 247
30 % 49 181 263
Entity #43 | Chains: Cj
40S ribosomal protein S16-like protein protein, length: 143 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13002
95 % 3 7 12446
90 % 3 7 12280
70 % 3 7 11695
50 % 49 174 256
40 % 49 178 259
30 % 49 179 276
Entity #44 | Chains: Ck
40S ribosomal protein S11-like protein protein, length: 161 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 5 18469
95 % 2 5 17832
90 % 2 5 17491
70 % 41 85 465
50 % 48 179 243
40 % 48 179 253
30 % 48 179 273
Entity #45 | Chains: Cm
40S ribosomal protein S22-like protein protein, length: 130 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13003
95 % 3 7 12354
90 % 3 7 12281
70 % 48 182 235
50 % 51 190 227
40 % 51 190 237
30 % 406 744 24
Entity #46 | Chains: Cn
40S ribosomal protein s23-like protein protein, length: 145 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13297
95 % 3 7 12699
90 % 3 7 12382
70 % 49 186 212
50 % 49 192 224
40 % 49 192 235
30 % 49 192 244
Entity #47 | Chains: Co
40S ribosomal protein S24 protein, length: 136 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 5 19640
95 % 2 5 17864
90 % 2 5 17519
70 % 2 5 16332
50 % 45 174 272
40 % 45 174 284
30 % 45 174 306
Entity #48 | Chains: Cp
40S ribosomal protein S28-like protein protein, length: 68 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13391
95 % 3 7 13193
90 % 3 7 13013
70 % 47 173 248
50 % 49 180 241
40 % 49 181 248
30 % 49 181 269
Entity #49 | Chains: CU
Faf1 protein, length: 311 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 12529
95 % 3 7 12703
90 % 3 7 12822
70 % 3 7 11786
50 % 3 7 10758
40 % 3 7 10131
30 % 3 7 9381
Entity #5 | Chains: UF
Utp6 protein, length: 414 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13415
95 % 3 7 13223
90 % 3 7 12555
70 % 3 7 12390
50 % 3 7 11324
40 % 3 7 10656
30 % 3 7 9856
Entity #50 | Chains: C1
35S ribosomal RNA rna, length: 2352 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
Entity #51 | Chains: C2
U3 snoRNA rna, length: 230 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
Entity #52 | Chains: UV
U3 small nucleolar RNA-associated protein 22 protein, length: 1171 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 4 28853
95 % 1 4 23843
90 % 1 4 20974
70 % 1 4 18721
50 % 1 4 16684
40 % 1 4 17191
30 % 1 4 15447
Entity #53 | Chains: CV
Rrp7 protein, length: 322 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 4 29673
95 % 1 4 24971
90 % 1 4 20912
70 % 1 4 19270
50 % 1 4 19477
40 % 1 4 15811
30 % 1 4 14263
Entity #54 | Chains: CW
Ribosome biogenesis protein ENP2 protein, length: 668 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 4 28091
95 % 2 4 22788
90 % 2 4 22130
70 % 2 4 20282
50 % 2 4 17978
40 % 2 4 16568
30 % 2 4 14924
Entity #55 | Chains: UT
Utp20 protein, length: 2612 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 4 28589
95 % 2 4 22787
90 % 2 4 22129
70 % 2 4 20280
50 % 2 4 17977
40 % 2 4 16567
30 % 2 4 14923
Entity #56 | Chains: UH
Utp8 protein, length: 930 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 6 15987
95 % 3 6 13919
90 % 3 6 15056
70 % 3 6 12973
50 % 3 6 11619
40 % 3 6 11108
30 % 3 6 11004
Entity #57 | Chains: UE,UI
Utp5 protein, length: 410 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 6 6999
95 % 3 6 7589
90 % 3 6 7573
70 % 3 6 7040
50 % 3 6 6677
40 % 3 6 6751
30 % 3 6 6347
Entity #58 | Chains: US
Noc4 protein, length: 549 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 6 16163
95 % 3 6 14198
90 % 3 6 14258
70 % 3 6 14154
50 % 3 6 12288
40 % 3 6 11956
30 % 3 6 10560
Entity #59 | Chains: Cl
Rps18 protein, length: 156 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 6 16763
95 % 3 6 15157
90 % 3 6 14908
70 % 47 165 258
50 % 49 174 257
40 % 49 180 252
30 % 49 180 272
Entity #6 | Chains: UG
Utp7 protein, length: 558 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13061
95 % 3 7 12574
90 % 3 7 12397
70 % 3 7 11796
50 % 3 7 10772
40 % 3 9 7980
30 % 3 9 7959
Entity #60 | Chains: CX
Enp1 protein, length: 480 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 6 17621
95 % 3 6 16483
90 % 3 6 16180
70 % 3 6 15153
50 % 3 6 13677
40 % 3 6 12744
30 % 3 14 5131
Entity #61 | Chains: CY
U3 small nucleolar ribonucleoprotein protein lcp5-like protein protein, length: 381 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 3 34196
95 % 2 3 26887
90 % 2 3 25934
70 % 2 3 23644
50 % 2 3 20767
40 % 2 3 19010
30 % 2 3 17059
Entity #62 | Chains: CZ
Bfr2 protein, length: 609 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 4 25226
95 % 2 4 18806
90 % 2 4 18390
70 % 2 4 17101
50 % 2 4 15385
40 % 2 4 14307
30 % 2 4 13023
Entity #63 | Chains: UP
Utp16 protein, length: 364 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 6 16762
95 % 3 6 15156
90 % 3 6 14136
70 % 3 6 14046
50 % 3 6 12181
40 % 3 6 11389
30 % 3 6 10916
Entity #7 | Chains: UJ
UTP10 protein, length: 1802 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 8 10718
95 % 3 8 11934
90 % 3 8 11756
70 % 3 8 11252
50 % 3 8 10297
40 % 3 8 9712
30 % 3 8 9002
Entity #8 | Chains: UK
U3 small nucleolar RNA-associated protein 11 protein, length: 270 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13413
95 % 3 7 13221
90 % 3 7 13039
70 % 3 7 12388
50 % 3 7 11322
40 % 3 7 10654
30 % 3 7 9539
Entity #9 | Chains: UL
Utp12 protein, length: 962 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13412
95 % 3 7 13220
90 % 3 7 13038
70 % 3 7 12387
50 % 3 7 11321
40 % 3 11 6812
30 % 3 11 6484

Instructions

In the table for each entity, view a list of similar sequences by selecting the link associated with the percentage cutoff.



View more detailed documentation on the redundancy reduction and sequence clustering procedure used by RCSB PDB.

You can also use the structure comparison tool to compare any 2 given structures


ACTION - (A) Select for download / view details OR (B) Select two chains for comparison
Rank PDB ID Entity ID Chains Description Details Taxonomy EC Number
1 1SEI 1 A, B RIBOSOMAL PROTEIN S8 1422
2 4YBB 8 AH, BH 30S ribosomal protein S8 562
3 4Y4O 39 1h, 2h 30S ribosomal protein S8 274
4 5J8B 41 h 30S ribosomal protein S8 274
5 1AN7 1 A, B RIBOSOMAL PROTEIN S8 274
6 4W2F 8 AH, CH 30S Ribosomal Protein S8 274
7 6CFL 39 1h, 2h 30S Ribosomal Protein S8 274
8 6CAE 39 1h, 2h 30S ribosomal protein S8 274
9 4Y4P 39 1h, 2h 30S ribosomal protein S8 274
10 1I6U 2 A, B 30S RIBOSOMAL PROTEIN S8P 2190
11 5FDV 40 1h, 2h 30S ribosomal protein S8 274
12 5J4B 39 1h, 2h 30S ribosomal protein S8 274
13 4W2G 8 AH, CH 30S Ribosomal Protein S8 274
14 6CFK 39 1h, 2h 30S ribosomal protein S8 274
15 5J7L 8 AH, BH 30S ribosomal protein S8 562
16 5W4K 39 1h, 2h 30S ribosomal protein S8 274
17 4LFB 8 H ribosomal protein S8 274
18 1VY4 8 AH, CH 30S ribosomal protein S8 274
19 4WOI 8 AH, DH 30S ribosomal protein S8 562
20 5FDU 39 1h, 2h 30S ribosomal protein S8 274
21 6I7V 12 AH, BH 30S ribosomal protein S8 562
22 4W2I 8 AH, CH 30S Ribosomal Protein S8 274
23 5JC9 8 AH, BH 30S ribosomal protein S8 562
24 1VY5 8 AH, CH 30S ribosomal protein S8 274
25 5HCQ 39 1h, 2h 30S ribosomal protein S8 274
26 4WQF 41 BH, DH 30S ribosomal protein S8 274
27 6ND5 39 1h, 2h 30S ribosomal protein S8 274
28 4W2H 8 AH, CH 30S Ribosomal Protein S8 274
29 4WPO 41 BH, DH 30S ribosomal protein S8 274
30 5J8A 8 AH, BH 30S ribosomal protein S8 562
31 4V8I 8 AH, CH 30S Ribosomal Protein S8 274
32 4JI1 8 H RIBOSOMAL PROTEIN S8 274
33 4V88 24 AW, CW 40S ribosomal protein S22-A 4932
34 4Z3S 39 1h, 2h 30S ribosomal protein S8 274
35 5DOY 39 1h, 2h 30S Ribosomal Protein S8 274
36 5J5B 8 AH, BH 30S ribosomal protein S8 562
37 5HD1 39 1h, 2h 30S ribosomal protein S8 274
38 4U4R 24 D2, d2 40S ribosomal protein S22-A 4932
39 4DR6 8 H 30S ribosomal protein S8 274
40 4LF7 8 H ribosomal protein S8 274
41 4LF8 8 H ribosomal protein S8 274
42 5WIS 39 1h, 2h 30S ribosomal protein S8 274
43 4WSD 8 72, 7E 30S ribosomal protein S8 274
44 4WQU 41 BH, DH 30S ribosomal protein S8 274
45 5WIT 39 1h, 2h 30S ribosomal protein S8 274
46 5E81 8 72, 7E 30S ribosomal protein S8 274
47 2VQE 8 H 30S RIBOSOMAL PROTEIN S8 274
48 6GSJ 8 72, 7E 30S ribosomal protein S8 274
49 4U27 8 AH, CH 30S ribosomal protein S8 562
50 6OF1 39 1h, 2h 30S ribosomal protein S8 274
51 6CFJ 39 1h, 2h 30S ribosomal protein S8 274
52 4U3U 24 D2, d2 40S ribosomal protein S22-A 4932
53 4Z8C 39 1h, 2h 30S ribosomal protein S8 274
54 5HCR 39 1h, 2h 30S ribosomal protein S8 274
55 5TBW 71 X, d2 40S ribosomal protein S22-A 4932
56 2UUB 8 H 30S RIBOSOMAL PROTEIN S8 274
57 4DV6 8 H ribosomal protein S8 274
58 4JYA 8 H 30S ribosomal protein S8 274
59 5IBB 8 72, 7E 30S ribosomal protein S8 274
60 4DR5 8 H 30S ribosomal protein S8 274
61 5J4C 39 1h, 2h 30S ribosomal protein S8 274
62 4KHP 8 H 30S Ribosomal protein S8 274
63 4DR2 8 H 30S ribosomal protein S8 274
64 4WRO 12 7E 30S ribosomal protein S8 274
65 4WQ1 8 72, 7E 30S ribosomal protein S8 274
66 4LF9 8 H ribosomal protein S8 274
67 4WQY 41 BH, DH 30S ribosomal protein S8 274
68 4DUY 8 H ribosomal protein S8 274
69 4U3M 24 D2, d2 40S ribosomal protein S22-A 4932
70 4DV7 8 H ribosomal protein S8 274
71 4WRA 8 72, 7E 30S ribosomal protein S8 274
72 1S03 2 G, H 30S ribosomal protein S8 562
73 5IB7 8 72, 7E 30S ribosomal protein S8 274
74 4U26 8 AH, CH 30S ribosomal protein S8 562
75 4X64 8 H 30S ribosomal protein S8 274
76 5HCP 39 1h, 2h 30S ribosomal protein S8 274
77 5IT8 8 AH, BH 30S ribosomal protein S8 562
78 4V9D 8 AH, BH 30S ribosomal protein S8 562
79 4V9P 40 BH, DH, FH, HH 30S ribosomal protein S8 562
80 4V9H 21 AH 30S ribosomal protein S8 274
81 4U3N 24 D2, d2 40S ribosomal protein S22-A 4932
82 5J91 8 AH, BH 30S ribosomal protein S8 562
83 4V8D 8 AK, CK 30S RIBOSOMAL PROTEIN S8 274
84 5WNT 8 H RIBOSOMAL PROTEIN S8 274
85 4DR3 8 H 30S ribosomal protein S8 274
86 4V90 8 AH 30S RIBOSOMAL PROTEIN S8 274
87 4JI3 8 H RIBOSOMAL PROTEIN S8 274
88 4WQR 8 72, 7E 30S ribosomal protein S8 274
89 4JI6 8 H RIBOSOMAL PROTEIN S8 274
90 4JI8 8 H RIBOSOMAL PROTEIN S8 274
91 2UXC 8 H RIBOSOMAL PROTEIN S8 274
92 5IB8 8 72, 7E 30S ribosomal protein S8 274
93 4V9R 8 AH, CH 30S Ribosomal Protein S8 274
94 4B3M 8 H 30S RIBOSOMAL PROTEIN S8 274
95 5EL6 8 72, 7E 30S ribosomal protein S8 274
96 6O97 39 1h, 2h 30S ribosomal protein S8 274
97 5EL7 8 72, 7E 30S ribosomal protein S8 274
98 5VP2 39 1h, 2h 30S ribosomal protein S8 274
99 4U52 24 D2, d2 40S ribosomal protein S22-A 4932
100 4LF4 8 H ribosomal protein S8 274
101 5DFE 42 QH, XH 30S ribosomal protein S8 274
102 5NDK 50 72, 7E 30S ribosomal protein S8 274
103 4LF6 8 H ribosomal protein S8 274
104 4JI7 8 H RIBOSOMAL PROTEIN S8 274
105 5J88 8 AH, BH 30S ribosomal protein S8 562
106 4U24 8 AH, CH 30S ribosomal protein S8 562
107 4WU1 8 72, 7E 30S ribosomal protein S8 274
108 4U4Q 24 D2, d2 40S ribosomal protein S22-A 4932
109 6QNR 8 72, 7E 30S ribosomal protein S8 274
110 5EL4 8 72, 7E 30S ribosomal protein S8 274
111 5WNV 8 H 30S ribosomal protein S8 274
112 4U6F 24 D2, d2 40S ribosomal protein S22-A 4932
113 4B3T 8 H 30S RIBOSOMAL PROTEIN S8 274
114 4WR6 8 72, 7E 30S ribosomal protein S8 274
115 4V8B 8 AK, CK 30S RIBOSOMAL PROTEIN S8 274
116 5HAU 41 1h, 2h 30S ribosomal protein S8 274
117 4V9O 41 BH, DH, FH, HH 30S ribosomal protein S8 562
118 6MPF 8 H 30S ribosomal protein S8 274
119 2VQF 8 H 30S RIBOSOMAL PROTEIN S8 274
120 2UUA 8 H 30S RIBOSOMAL PROTEIN S8 274
121 4V87 38 BK, CK 30S RIBOSOMAL PROTEIN S8 274
122 4WF1 8 AH, CH 30S ribosomal protein S8 562
123 4U25 8 AH, CH 30S ribosomal protein S8 562
124 4V95 8 AH, CH 30S Ribosomal Protein S8 274
125 4WWW 39 QH, XH 30S ribosomal protein S8 562
126 4V7T 8 AH, CH 30S ribosomal protein S8 562
127 1VY7 8 AH, CH 30S ribosomal protein S8 274
128 4U4U 24 D2, d2 40S ribosomal protein S22-A 4932
129 5E7K 8 72, 7E 30S ribosomal protein S8 274
130 4U4Z 24 D2, d2 40S ribosomal protein S22-A 4932
131 5EL5 8 72, 7E 30S ribosomal protein S8 274
132 6FKR 39 1h, 2h 30S ribosomal protein S8 274
133 4B3R 8 H 30S RIBOSOMAL PROTEIN S8 274
134 4LNT 8 QH, XH 30S ribosomal protein S8 274
135 4U4Y 24 D2, d2 40S ribosomal protein S22-A 4932
136 4DR1 8 H 30S ribosomal protein S8 274
137 4LFA 8 H ribosomal protein S8 274
138 4U4N 24 D2, d2 40S ribosomal protein S22-A 4932
139 4DV4 8 H ribosomal protein S8 274
140 4U55 24 D2, d2 40S ribosomal protein S22-A 4932
141 4YZV 8 QH, XH 30S ribosomal protein S8 274
142 4JI0 8 H ribosomal protein S8 274
143 5IWA 7 H 30S ribosomal protein S8 274
144 4V7U 8 AH, CH 30S ribosomal protein S8 562
145 4V9S 8 AH, CH 30S Ribosomal Protein S8 274
146 4JI2 8 H RIBOSOMAL PROTEIN S8 274
147 4V6C 7 AH, CH 30S ribosomal protein S8 562
148 4JV5 8 H 30S ribosomal protein S8 274
149 4DR7 8 H 30S ribosomal protein S8 274
150 1J5E 8 H 30S RIBOSOMAL PROTEIN S8 274
151 4GKK 8 H 30S ribosomal protein S8 274
152 4DUZ 8 H ribosomal protein S8 274
153 5NDJ 50 72, 7E 30S ribosomal protein S8 274
154 4V7V 8 AH, CH 30S ribosomal protein S8 562
155 4X65 8 H 30S ribosomal protein S8 274
156 4V8G 8 AH, CH 30S Ribosomal Protein S8 274
157 4GKJ 8 H 30S ribosomal protein S8 274
158 4DV3 8 H ribosomal protein S8 274
159 4V7S 8 AH, CH 30S ribosomal protein S8 562
160 4DV5 8 H ribosomal protein S8 274
161 5DAT 24 D2 40S ribosomal protein S22-A 4932
162 5DAT 80 d2 40S ribosomal protein S22-A 4932
163 2UUC 8 H 30S RIBOSOMAL PROTEIN S8 274
164 4LFC 8 H ribosomal protein S8 274
165 1FJG 9 H 30S RIBOSOMAL PROTEIN S8 274
166 3T1Y 8 H 30S ribosomal protein S8 274
167 4WZO 8 72, 7E 30S ribosomal protein S8 274
168 4JI4 8 H RIBOSOMAL PROTEIN S8 274
169 1VY6 8 AH, CH 30S ribosomal protein S8 274
170 1XMQ 10 H 30S Ribosomal Protein S8 274
171 5WNP 8 H 30S ribosomal protein S8 274
172 6CAP 8 H 30S ribosomal protein S8 274
173 4U20 8 AH, CH 30S ribosomal protein S8 562
174 6MPI 8 H 30S ribosomal protein S8 274
175 5I4L 24 D2, d2 40S ribosomal protein S22-A 4932
176 4DV0 8 H ribosomal protein S8 274
177 4V9B 8 AK, CK 30S RIBOSOMAL PROTEIN S8 274
178 4U1V 8 AH, CH 30S ribosomal protein S8 562
179 4V6F 38 BK, CK 30S ribosomal protein S8 274
180 4X62 8 H 30S ribosomal protein S8 274
181 4V8F 38 BK, CK 30S RIBOSOMAL PROTEIN S8 274
182 4U51 24 D2, d2 40S ribosomal protein S22-A 4932
183 4B3S 8 H 30S RIBOSOMAL PROTEIN S8 274
184 4DV2 8 H ribosomal protein S8 274
185 4DV1 8 H ribosomal protein S8 274
186 5WNU 8 H 30S ribosomal protein S8 274
187 1N32 10 H 30S RIBOSOMAL PROTEIN S8 274
188 5F8K 39 1h, 2h 30S ribosomal protein S8 274
189 1I94 8 H 30S RIBOSOMAL PROTEIN S8 274
190 6HHQ 70 X, d2 40S ribosomal protein S22-A 4932
191 4V8H 8 AH, CH 30S Ribosomal Protein S8 274
192 5OBM 68 D2, d2 40S ribosomal protein S22-A 4932
193 4JI5 8 H RIBOSOMAL PROTEIN S8 274
194 6CAQ 8 H 30S ribosomal protein S8 274
195 4K0K 8 H 30S ribosomal protein S8 274
196 4W2E 41 h 30S ribosomal protein S8 274
197 4V8C 38 CK, DK 30S RIBOSOMAL PROTEIN S8 274
198 5BR8 8 H 30S ribosomal protein S8 274
199 4LF5 8 H ribosomal protein S8 274
200 5J4D 42 QA, VC 30S ribosomal protein S8 274
201 4V9A 8 AK, CK 30S RIBOSOMAL PROTEIN S8 274
202 4U53 24 D2, d2 40S ribosomal protein S22-A 4932
203 5ON6 72 X, d2 40S ribosomal protein S22-A 4932
204 4V5J 8 AH, CH 30S RIBOSOMAL PROTEIN S8 274
205 4U50 24 D2, d2 40S ribosomal protein S22-A 4932
206 5NDV 68 D2, d2 40S ribosomal protein S22-A 4932
207 5LYB 24 D2, d2 40S ribosomal protein S22-A 4932
208 6ND6 39 1h, 2h 30S ribosomal protein S8 274
209 4V7Y 8 AH, CH 30S ribosomal protein S8 274
210 6UO1 39 1h, 2h 30S ribosomal protein S8 274
211 6GSK 8 72, 7E 30S ribosomal protein S8 274
212 4V9C 8 AH, CH 30S ribosomal protein S8 562
213 4V8E 38 BK, DK 30S RIBOSOMAL PROTEIN S8 274
214 5J30 39 QH, XH 30S ribosomal protein S8 274
215 6QNQ 8 72, 7E 30S ribosomal protein S8 274
216 4DR4 8 H 30S ribosomal protein S8 274
217 4WZD 8 72, 7E 30S ribosomal protein S8 274
218 3OTO 8 H 30S RIBOSOMAL PROTEIN S8 274
219 4X66 8 H 30S ribosomal protein S8 274
220 2UU9 8 H 30S RIBOSOMAL PROTEIN S8 274
221 4V8Q 42 BH 30S RIBOSOMAL PROTEIN S8 274
222 4U56 24 D2, d2 40S ribosomal protein S22-A 4932
223 4V85 8 AH 30S ribosomal protein S8 562
224 1HR0 9 H 30S RIBOSOMAL PROTEIN S8 274
225 4AQY 8 H 30S RIBOSOMAL PROTEIN S8 274
226 4W4G 8 QH, XH 30S ribosomal protein S8 274
227 4NXM 8 H ribosomal protein S8 274
228 4V5L 8 AH 30S RIBOSOMAL PROTEIN S8 274
229 4YPB 8 QH, XH 30S ribosomal protein S8 274
230 4V7X 8 AH, CH 30S ribosomal protein S8 274
231 5TGA 24 D2, d2 40S ribosomal protein S22-A 4932
232 4U1U 8 AH, CH 30S ribosomal protein S8 562
233 4ZER 39 1h, 2h 30S ribosomal protein S8 274
234 1IBL 11 H 30S RIBOSOMAL PROTEIN S8 274
235 5MEI 71 X, d2 40S ribosomal protein S22-A 4932
236 4V7W 8 AH, CH 30S ribosomal protein S8 274
237 4WT1 8 72, 7E 30S ribosomal protein S8 274
238 6C5L 8 AH, CH 30S ribosomal protein S8 274
239 4WT8 8 AH, BH 30S ribosomal protein S8 274
240 5DOX 39 1h, 2h 30S ribosomal protein S8 274
241 6OTR 8 QH, XH 30S ribosomal protein S8 274
242 4NXN 8 H ribosomal protein S8 274
243 1XNR 10 H 16S Ribosomal protein S8 274
244 4LT8 8 QH, XH 30S ribosomal protein S8 274
245 5FCJ 24 D2, d2 40S ribosomal protein S22-A 4932
246 5WNQ 8 H 30S ribosomal protein S8 274
247 4U4O 24 D2, d2 40S ribosomal protein S22-A 4932
248 6MKN 8 H 30S ribosomal protein S8 274
249 4V51 8 AH, CH 30S RIBOSOMAL PROTEIN S8 274
250 6DTI 8 H 30S ribosomal protein S8 274
251 4V7L 8 AH, CH 30S ribosomal protein S8 274
252 4V5R 8 AH, CH 30S RIBOSOMAL PROTEIN S8 274
253 1HNZ 9 H 30S RIBOSOMAL PROTEIN S8 274
254 1XNQ 10 H Ribosomal protein S8 274
255 4V8A 38 CH, DH 30S ribosomal protein S8 274
256 4V5K 8 AH, CH 30S RIBOSOMAL PROTEIN S8 274
257 4V5Q 8 AH, CH 30S RIBOSOMAL PROTEIN S8 274
258 4V7J 7 Ah, Bh 30S ribosomal protein S8 274
259 5DGV 24 D2, d2 40S ribosomal protein S22-A 4932
260 6BZ6 8 QH, XH 30S ribosomal protein S8 274
261 5DGE 24 D2, d2 40S ribosomal protein S22-A 4932
262 5J3C 39 QH, XH 30S ribosomal protein S8 274
263 4V5C 8 AH, CH 30S RIBOSOMAL PROTEIN S8 274
264 4V5E 8 AH, CH 30S RIBOSOMAL PROTEIN S8 274
265 4L47 8 QH, XH 30S ribosomal protein S8 274
266 4V5P 8 AH, CH 30S RIBOSOMAL PROTEIN S8 274
267 5V8I 39 1h, 2h 30S ribosomal protein S8 274
268 4ZSN 8 QH, XH 30S ribosomal protein S8 274
269 4V5D 8 AH, CH 30S RIBOSOMAL PROTEIN S8 274
270 5NDW 17 D2, d2 40S ribosomal protein S22-A 4932
271 6CZR 39 1h, 2h 30S ribosomal protein S8 274
272 6OXA 8 QH, XH 30S ribosomal protein S8 274
273 6BUW 8 QH, XH 30S ribosomal protein S8 274
274 4V7Z 8 AH, CH 30S ribosomal protein S8 274
275 4V8X 8 AH, CH 30S RIBOSOMAL PROTEIN S8 274
276 4V5S 8 AH, CH 30S RIBOSOMAL PROTEIN S8 274
277 4V9I 8 AH, CH 30S Ribosomal protein S8 274
278 1XMO 10 H 30S ribosomal protein S8 274
279 3T1H 8 H 30S ribosomal protein S8 274
280 2UXD 8 H RIBOSOMAL PROTEIN S8 274
281 1N33 10 H 30S RIBOSOMAL PROTEIN S8 274
282 1IBK 9 H 30S RIBOSOMAL PROTEIN S8 274
283 4V6G 8 AK, CK 30S RIBOSOMAL PROTEIN S8 274
284 4V8N 8 AH, CH 30S RIBOSOMAL PROTEIN S8 274
285 4V97 8 AH, CH 30S ribosomal protein S8 274
286 6CAR 8 H 30S ribosomal protein S8 274
287 1HNW 9 H 30S RIBOSOMAL PROTEIN S8 274
288 4V7M 8 AH, CH 30S ribosomal protein S8 274
289 4WSM 8 72, 7E 30S ribosomal protein S8 274
290 4TUD 8 QH, XH 30S ribosomal protein S8 274
291 1IBM 11 H 30S RIBOSOMAL PROTEIN S8 274
292 5WNR 8 H 30S ribosomal protein S8 274
293 6CAO 8 H 30S ribosomal protein S8 274
294 4V6A 8 AH, CH 30S ribosomal protein S8 274
295 4TUE 8 QH, XH 30S ribosomal protein S8 274
296 6OXI 8 QH, XH 30S ribosomal protein S8 274
297 4TUA 8 QH, XH 30S ribosomal protein S8 274
298 4BTS 18 AH, BH, CH, DH 40S RIBOSOMAL PROTEIN RPS22E 5911
299 4V84 8 AH, CH 30S ribosomal protein S8 274
300 5WNS 8 H 30S ribosomal protein S8 274
301 6NDK 8 QH, XH 30S ribosomal protein S8 274
302 4V7K 7 Ah, Bh 30S ribosomal protein S8 274
303 4YY3 8 H 30S ribosomal protein S8 274
304 1HNX 9 H 30S RIBOSOMAL PROTEIN S8 274
305 4V9Q 38 BH, DH 30S ribosomal protein S8 274
306 6BZ8 8 QH, XH 30S ribosomal protein S8 274
307 4TUC 8 QH, XH 30S ribosomal protein S8 274
308 4YHH 8 H 30S ribosomal protein S8 274
309 5VPO 9 QH, XH 30S ribosomal protein S8 274
310 6NY6 8 H 30S ribosomal protein S8 274
311 5NDG 24 D2, d2 40S ribosomal protein S22-A 4932
312 4TUB 8 QH, XH 30S ribosomal protein S8 274
313 4V9N 11 AH, CH 30S ribosomal protein S8 274
314 5FCI 24 D2, d2 40S ribosomal protein S22-A 4932
315 4P70 8 QH, XH 30S ribosomal protein S8 274
316 4V8U 8 AH, CH 30S RIBOSOMAL PROTEIN S8 274
317 4LSK 8 QH, XH 30S ribosomal protein S8 274
318 5DC3 24 D2, d2 40S ribosomal protein S22-A 4932
319 4V6D 7 AH, CH 30S ribosomal protein S8 562
320 4P6F 8 QH, XH 30S ribosomal protein S8 274
321 4V67 10 AH, CH 30S ribosomal protein S8 274
322 4V83 8 AH, CH 30S ribosomal protein S8 274
323 5DGF 24 D2, d2 40S ribosomal protein S22-A 4932
324 4V5F 8 AH, CH 30S RIBOSOMAL PROTEIN S8 274
325 4V5O 17 AH, BH RIBOSOMAL PROTEIN S8 CONTAINING PROTEIN 5911
326 1VVJ 8 QH, XH 30S ribosomal protein S8 274
327 4LFZ 8 QH, XH 30S ribosomal protein S8 274
328 2E5L 9 H 30S ribosomal protein S8 274
329 6BZ7 8 QH, XH 30S ribosomal protein S8 274
330 6N1D 42 AS08, BS08 30S ribosomal protein S8 274
331 4V6E 7 AH, CH 30S ribosomal protein S8 562
332 6CAS 8 H 30S ribosomal protein S8 274
333 4V52 7 AH, CH 30S ribosomal protein S8 562
334 5CZP 39 QH, XH 30S ribosomal protein S8 274
335 6N9F 39 1h, 2h 30S Ribosomal Protein S8 274
336 6N9E 39 1h, 2h 30S Ribosomal Protein S8 274
337 2HHH 8 H 30S ribosomal protein S8 274
338 4V89 8 AH 30S ribosomal protein S8 562
339 4OX9 8 H 30S ribosomal protein S8 274
340 4V54 7 AH, CH 30S ribosomal protein S8 562
341 2UXB 8 H RIBOSOMAL PROTEIN S8 274
342 1I96 8 H 30S RIBOSOMAL PROTEIN S8 274
343 5TGM 24 D2, d2 40S ribosomal protein S22-A 4932
344 4V9K 7 AH, CH 30S ribosomal protein S8 274
345 4V50 10 AH, CH 30S ribosomal protein S8 562
346 1N34 9 H 30S RIBOSOMAL PROTEIN S8 274
347 4V57 7 AH, CH 30S ribosomal protein S8 562
348 4V5A 8 AH, CH 30S RIBOSOMAL PROTEIN S8 274
349 4V63 10 AH, CH 30S ribosomal protein S8 274
350 4L71 8 QH, XH 30S ribosomal protein S8 274
351 4KVB 8 H 30S ribosomal protein S8 274
352 4XEJ 35 AS08, BS08 30S ribosomal protein S8 274
353 4V64 7 AH, CH 30S ribosomal protein S8 562
354 4V7P 8 AH, DH 30S ribosomal protein S8 274
355 4V8J 8 AH, CH 30S ribosomal protein S8 274
356 1N36 8 H 30S RIBOSOMAL PROTEIN S8 274
357 2ZM6 8 H 30S ribosomal protein S8 274
358 4V4H 7 AH, CH 30S RIBOSOMAL PROTEIN S8 562
359 4V4Q 7 AH, CH 30S ribosomal protein S8 562
360 4V5B 40 BH, DH 30S RIBOSOMAL PROTEIN S8 RESIDUES 2-130 562
361 5D8B 35 EC, IA 30S ribosomal protein S8 274
362 6BY1 43 AH, BH 30S ribosomal protein S8 562
363 4LEL 8 QH, XH 30S ribosomal protein S8 274
364 4V53 7 AH, CH 30S ribosomal protein S8 562
365 2F4V 9 H 30S ribosomal protein S8 274
366 4V9L 7 AH, CH 30S ribosomal protein S8 274
367 1FKA 8 H 30S RIBOSOMAL PROTEIN S8 274
368 4V5G 8 AH, CH 30S RIBOSOMAL PROTEIN S8 274
369 4V56 7 AH, CH 30S ribosomal protein S8 562
370 1I97 8 H 30S RIBOSOMAL PROTEIN S8 274
371 4V9J 7 AH, CH 30S ribosomal protein S8 274
372 4V55 7 AH, CH 30S ribosomal protein S8 562
373 1I95 8 H 30S RIBOSOMAL PROTEIN S8 274
374 4V8O 8 AH 30S RIBOSOMAL PROTEIN S8 274
375 4V7R 16 AO, CO 40S ribosomal protein S22-A 4932
376 4V9M 7 AH, CH 30S ribosomal protein S8 274
377 4W29 7 AH, CH 30S ribosomal protein S8 274
378 4V5Y 7 AH, CH 30S ribosomal protein S8 562
379 4V4Y 10 AK 30S ribosomal protein S8 274
380 4V4J 41 i 30S ribosomal protein S8 274
381 4V4X 10 AK 30S ribosomal protein S8 274
382 4V4Z 11 AK 30S ribosomal protein S8 274
383 4V4I 41 i 30S ribosomal protein S8 274
384 4V4P 43 BK 30S ribosomal protein S8 274
385 5VYC 16 W1, W2, W3, W4, W5, W6 40S ribosomal protein S15a 9606
386 4V4R 11 AH 30S ribosomal protein S8 274
387 4V4S 11 AH 30S ribosomal protein S8 274
388 4V4T 11 AH 30S ribosomal protein S8 274
389 4KZZ 23 W 40S Ribosomal Protein S15A 9986
390 4KZX 23 W 40S ribosomal protein S15A 9986
391 4KZY 23 W 40S Ribosomal Protein S15A 9986
392 4V49 10 AH 30S ribosomal protein S8 562
393 4V4A 8 AH 30S ribosomal protein S8 562
394 4V4G 8 AH, CH, EH, GH, IH 30S ribosomal protein S8 562
395 6SZS 39 h 30S ribosomal protein S8 562
396 6SPC 8 h 30S ribosomal protein S8 287
397 6SPE 8 h 30S ribosomal protein S8 287
398 6SPF 40 h 30S ribosomal protein S8 287
399 6SPG 8 h 30S ribosomal protein S8 287
400 6SGC 24 X1 Ribosomal protein S15a 9986
401 6S47 68 BX 40S ribosomal protein S22-A TRSSVLADALNAINNAEKTGKRQVLIRPSSKVIIKFLQVMQKHGYIGEFEYIDDHRSGK IVVQLNGRLNKCGVISPRFNVKIGDIEKWTANLLPARQFGYVILTTSAGIMDHEEARRKH VSGKILGFVY 4932
402 6S0X 38 h 30S ribosomal protein S8 1280
403 6S13 38 h 30S ribosomal protein S8 1280
404 6RXT 41 Cm 40S ribosomal protein S22-like protein 209285
405 6RXU 45 Cm 40S ribosomal protein S22-like protein 209285
406 6RXV 45 Cm 40S ribosomal protein S22-like protein 209285
407 6RXX 26 Cm 40S ribosomal protein S22-like protein 209285
408 6RXY 40 Cm 40S ribosomal protein S22-like protein 209285
409 6RXZ 44 Cm 40S ribosomal protein S22-like protein 209285
410 6P5I 24 X uS8 9986
411 6P5J 24 X uS8 9986
412 6P5K 70 X uS8 9986
413 6P5N 70 X uS8 9986
414 6P4G 24 X uS8 9986
415 6P4H 25 X uS8 9986
416 6OUO 40 m 30S ribosomal protein S8 562
417 6RM3 69 SW0 uS8 6039
418 6OSQ 41 m 30S ribosomal protein S8 562
419 6OST 38 m 30S ribosomal protein S8 562
420 6OT3 40 m 30S ribosomal protein S8 562
421 6OSK 40 m 30S ribosomal protein S8 562
422 6ORE 42 m 30S ribosomal protein S8 562
423 6ORL 38 m 30S ribosomal protein S8 562
424 6OM7 29 SW 40S ribosomal protein S15a 9606
425 6OLZ 69 BW 40S ribosomal protein S15a 9606
426 6OM0 29 SW 40S ribosomal protein S15a 9606
427 6OLE 29 SW 40S ribosomal protein S15a 9606
428 6OLF 29 SW 40S ribosomal protein S15a 9606
429 6OLG 72 BW 40S ribosomal protein S15a 9606
430 6OLI 29 SW 40S ribosomal protein S15a 9606
431 6OKK 11 K 40S ribosomal protein S15A 5833
432 6RBD 15 W 40S ribosomal protein S22-A 4932
433 6RBE 15 W 40S ribosomal protein S22-A 4932
434 6OGF 35 M 30S ribosomal protein S8 562
435 6OGG 35 M 30S ribosomal protein S8 562
436 6OGI 35 M 30S ribosomal protein S8 562
437 6OFX 35 M 30S ribosomal protein S8 562
438 6OG7 35 M 30S ribosomal protein S8 562
439 6R7Q 82 TT Ribosomal protein S15a 9986
440 6R6G 50 TT Ribosomal protein S15a 9986
441 6R6P 66 TT Ribosomal protein S15a 9986
442 6R5Q 74 TT Ribosomal protein S15a 9986
443 6O9J 38 h 30S ribosomal protein S8 562
444 6O9K 8 h 30S ribosomal protein S8 562
445 6QZP 76 SW 40S ribosomal protein S15a 9606
446 6O7K 22 p 30S ribosomal protein S8 562
447 6NQB 9 H 30S ribosomal protein S8 562
448 6Q95 8 m 30S ribosomal protein S8 274
449 6Q97 45 m 30S ribosomal protein S8 562
450 6Q98 43 m 30S ribosomal protein S8 562
451 6Q9A 43 m 30S ribosomal protein S8 562
452 6Q8Y 27 b 40S ribosomal protein S22-A 4932
453 6I7O 41 b, bb 40S ribosomal protein S22-A 4932
454 6IP5 75 3M 40S ribosomal protein S15a 9606
455 6IP6 74 3M 40S ribosomal protein S15a 9606
456 6IP8 74 3M 40S ribosomal protein S15a 9606
457 6MTB 73 WW 40S ribosomal protein S15a 9986
458 6MTC 72 WW 40S ribosomal protein S15a 9986
459 6MTD 74 WW uS8 9986
460 6MTE 73 WW uS8 9986
461 6HTQ 37 h 30S ribosomal protein S8 1423
462 6HRM 40 m 30S ribosomal protein S8 562
463 6HCQ 27 X2 Ribosomal protein S15a 9986
464 6HCJ 27 X2 Ribosomal protein S15a 9986
465 6HCM 24 X1 Ribosomal protein S15a 9986
466 6HCF 24 X1 Ribosomal protein S15a 9986
467 6HA1 38 h 30S ribosomal protein S8 1423
468 6HA8 40 h 30S ribosomal protein S8 1423
469 6H58 39 h, hh 30S ribosomal protein S8 562
470 6H4N 8 h 30S ribosomal protein S8 562
471 6DZI 8 q 30S ribosomal protein S8 1772
472 6DZK 8 H 30S ribosomal protein S8 1772
473 6GZX 38 H3, H4 30S ribosomal protein S8 274
474 6GZZ 38 H3, H4 30S ribosomal protein S8 274
475 6GZQ 38 H2 30S ribosomal protein S8 274
476 6GZ3 33 BW Ribosomal protein S15a 9986
477 6GZ4 36 BW ribosomal protein uS8 9986
478 6GZ5 33 BW ribosomal protein uS8 9986
479 6GXM 41 h 30S ribosomal protein S8 562
480 6GXN 41 h 30S ribosomal protein S8 562
481 6GXO 41 h 30S ribosomal protein S8 562
482 6GXP 40 h 30S ribosomal protein S8 562
483 6GWT 41 h 30S ribosomal protein S8 562
484 6GSL 8 72, 7E 30S ribosomal protein S8 274
485 6GSM 26 W 40S ribosomal protein S22 28985
486 6GSN 40 W 40S ribosomal protein S22 28985
487 6GQV 70 AM 40S ribosomal protein S22-A 4932
488 6GQ1 70 AM 40S ribosomal protein S22-A 4932
489 6GQB 70 AM 40S ribosomal protein S22-A 4932
490 6DNC 45 UA 30S ribosomal protein S8 562
491 6D9J 72 XX uS8 9986
492 6D90 73 XX uS8 9986
493 5ZLU 15 N 30S ribosomal protein S8 274
494 6G5H 14 W 40S ribosomal protein S15a 9606
495 6G5I 24 W 40S ribosomal protein S15a 9606
496 6G4S 19 W 40S ribosomal protein S15a 9606
497 6G4W 16 W 40S ribosomal protein S15a 9606
498 6G51 15 W 40S ribosomal protein S15a 9606
499 6G53 15 W 40S ribosomal protein S15a 9606
500 6G18 25 W 40S ribosomal protein S15a 9606
501 6FYX 26 W 40S ribosomal protein S22 28985
502 6FYY 26 W 40S ribosomal protein S22 28985
503 6FXC 8 Ah, Bh 30S ribosomal protein S8 1280
504 5ZEU 5 h 30S ribosomal protein S8 1772
505 5ZEB 5 h 30S ribosomal protein S8 1772
506 5ZEP 5 h 30S ribosomal protein S8 1772
507 6C4I 41 h 30S ribosomal protein S8 562
508 6FEC 29 a 40S ribosomal protein S15a 9606
509 6FAI 33 W 40S ribosomal protein S22-A 4932
510 6BU8 38 H 30S ribosomal protein S8 562
511 6BOH 42 RA, WC 30S ribosomal protein S8 274
512 6BOK 41 PA, SC 30S ribosomal protein S8 274
513 6ERI 41 BH 30S ribosomal protein S8, chloroplastic 3562
514 6ENU 8 h 30S ribosomal protein S8 562
515 6ENJ 38 h 30S ribosomal protein S8 562
516 6ENF 8 h 30S ribosomal protein S8 562
517 6EML 24 b 40S ribosomal protein S22-A 4932
518 6B4V 42 QA, UC 30S ribosomal protein S8 274
519 6EK0 76 SW 40S ribosomal protein S15a 9606
520 6AZ1 10 J ribosomal protein S8 5661
521 6AWB 13 K 30S ribosomal protein S8 562
522 6AWC 13 K 30S ribosomal protein S8 562
523 6AWD 12 K 30S ribosomal protein S8 562
524 5OT7 14 G 30S ribosomal protein S8 274
525 5OQL 45 w 40S ribosomal protein S22-like protein 209285
526 5OPT 22 e 40S ribosomal protein S15a, putative 5693
527 5WLC 13 LE rpS22_uS8 4932
528 5WFK 41 h 30S ribosomal protein S8 562
529 5WFS 41 h 30S ribosomal protein S8 562
530 5WF0 41 h 30S ribosomal protein S8 562
531 5XYU 7 H 30S ribosomal protein S8 1772
532 5XYI 24 W Ribosomal protein S15a 5722
533 5WE4 41 h 30S ribosomal protein S8 562
534 5WE6 41 h 30S ribosomal protein S8 562
535 5WDT 41 h 30S ribosomal protein S8 562
536 5XXU 24 W Ribosomal protein uS8 5811
537 5OA3 27 W 40S ribosomal protein S15a 9606
538 5O61 42 BH 30S ribosomal protein S8 1772
539 5O5J 8 H 30S ribosomal protein S8 1772
540 5O2R 42 h 30S ribosomal protein S8 562
541 5NWY 42 7 30S ribosomal protein S8 562
542 5VPP 37 QH, XH 30S ribosomal protein S8 274
543 5NP6 11 K 30S ribosomal protein S8 562
544 5NO2 6 H 30S ribosomal protein S8 562
545 5NO3 7 H 30S ribosomal protein S8 562
546 5NO4 7 H 30S ribosomal protein S8 562
547 5NJT 8 H 30S ribosomal protein S8 1423
548 5V93 39 h 30S ribosomal protein S8 1773
549 5NGM 8 Ah 30S ribosomal protein S8