6RXV

Cryo-EM structure of the 90S pre-ribosome (Kre33-Noc4) from Chaetomium thermophilum, state B2


Sequence Similarity Clusters for the Entities in PDB 6RXV

Entity #1 | Chains: UA
Periodic tryptophan protein 2-like protein protein, length: 904 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 14249
95 % 3 7 13651
90 % 3 7 13466
70 % 3 7 12689
50 % 17 25 3310
40 % 17 25 3282
30 % 17 25 3247
Entity #10 | Chains: UM
Utp13 protein, length: 912 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 14453
95 % 3 7 14067
90 % 3 7 14274
70 % 3 7 13067
50 % 3 7 11893
40 % 3 7 11157
30 % 3 7 10302
Entity #11 | Chains: UN
Utp14 protein, length: 938 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13650
95 % 3 7 13681
90 % 3 7 13494
70 % 3 7 12487
50 % 3 7 11592
40 % 3 7 10680
30 % 3 7 9873
Entity #12 | Chains: UO
Utp15 protein, length: 557 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 14447
95 % 3 7 13968
90 % 3 7 13857
70 % 3 7 13051
50 % 3 7 12001
40 % 3 7 11144
30 % 16 22 3640
Entity #13 | Chains: UQ
Utp17 protein, length: 960 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13527
95 % 3 7 13413
90 % 3 7 13495
70 % 3 7 12708
50 % 3 7 11383
40 % 3 7 10882
30 % 3 7 9874
Entity #14 | Chains: UR
Utp18 protein, length: 618 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 14114
95 % 3 7 13397
90 % 3 7 13214
70 % 3 7 12467
50 % 3 7 11369
40 % 3 7 10669
30 % 16 24 3364
Entity #15 | Chains: UU
Utp21 protein, length: 1049 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13944
95 % 3 7 14254
90 % 3 7 14040
70 % 3 7 13216
50 % 3 7 12066
40 % 3 7 11300
30 % 3 7 10428
Entity #16 | Chains: UX
Utp24 protein, length: 193 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 8 13071
95 % 3 8 12396
90 % 3 8 12230
70 % 3 8 11626
50 % 17 26 3270
40 % 17 26 3241
30 % 17 26 3216
Entity #17 | Chains: UZ
Utp30 protein, length: 391 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13760
95 % 3 7 14255
90 % 3 7 14041
70 % 3 7 13217
50 % 3 7 12067
40 % 3 7 11301
30 % 3 7 10429
Entity #18 | Chains: CA,CB
Nop1 protein, length: 313 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 5664
95 % 3 7 6291
90 % 3 7 6324
70 % 3 7 6275
50 % 16 24 1632
40 % 16 24 1672
30 % 16 24 1700
Entity #19 | Chains: CC
Nop56 protein, length: 523 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13759
95 % 3 7 13904
90 % 3 7 13727
70 % 3 7 13215
50 % 16 24 3610
40 % 29 41 1984
30 % 29 41 1995
Entity #2 | Chains: UB
Utp2 protein, length: 907 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 14265
95 % 3 7 14287
90 % 3 7 13504
70 % 3 7 12713
50 % 3 7 11602
40 % 3 7 11329
30 % 3 7 10455
Entity #20 | Chains: CD
Nop58 protein, length: 582 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 14659
95 % 3 7 14466
90 % 3 7 14255
70 % 3 7 13413
50 % 3 7 12311
40 % 3 7 11479
30 % 3 7 10572
Entity #21 | Chains: CE,CF
Snu13 protein, length: 127 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 5818
95 % 3 7 6592
90 % 3 7 6631
70 % 3 7 6550
50 % 25 47 947
40 % 26 48 958
30 % 25 47 1028
Entity #22 | Chains: CG
Rrp9 protein, length: 630 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 14487
95 % 3 7 14137
90 % 3 7 13941
70 % 3 7 12988
50 % 3 7 11970
40 % 3 7 11097
30 % 3 7 10240
Entity #23 | Chains: CH
RNA 3'-terminal phosphate cyclase-like protein protein, length: 411 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13693
95 % 3 7 13782
90 % 3 7 13599
70 % 3 7 12808
50 % 3 7 11678
40 % 3 7 10948
30 % 3 7 10109
Entity #24 | Chains: CI
Bms1 protein, length: 1163 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 14411
95 % 3 7 13987
90 % 3 7 13802
70 % 3 7 12989
50 % 3 7 11843
40 % 18 26 3248
30 % 18 26 3222
Entity #25 | Chains: CJ
Imp3 protein, length: 183 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 8 11716
95 % 3 8 11116
90 % 3 8 12803
70 % 3 8 10575
50 % 17 26 3160
40 % 17 26 3140
30 % 17 26 3114
Entity #26 | Chains: CK
Imp4 protein, length: 297 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 8 11028
95 % 3 8 11844
90 % 3 8 11422
70 % 3 8 11163
50 % 18 26 3269
40 % 18 26 3240
30 % 18 26 3215
Entity #27 | Chains: CL
Mpp10 protein, length: 785 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13755
95 % 3 7 14390
90 % 3 7 13721
70 % 3 7 12907
50 % 3 7 11774
40 % 3 7 11032
30 % 3 7 10185
Entity #28 | Chains: CM
Sof1 protein, length: 446 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 14658
95 % 3 7 13758
90 % 3 7 13575
70 % 3 7 12784
50 % 3 7 12244
40 % 15 21 4037
30 % 15 21 3888
Entity #29 | Chains: CN,CO
Emg1 protein, length: 252 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 5776
95 % 3 7 6337
90 % 3 7 6377
70 % 23 32 1242
50 % 23 32 1278
40 % 23 32 1320
30 % 23 32 1360
Entity #3 | Chains: UC
Utp3 protein, length: 648 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 14007
95 % 3 7 14381
90 % 3 7 14165
70 % 3 7 13323
50 % 3 7 12163
40 % 3 7 11406
30 % 18 23 3595
Entity #30 | Chains: CP
KRR1 small subunit processome component protein, length: 322 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 8 9511
95 % 3 8 10341
90 % 3 8 10250
70 % 10 18 4648
50 % 10 18 4436
40 % 10 18 4359
30 % 10 18 4265
Entity #31 | Chains: CQ
Pre-rRNA-processing protein PNO1 protein, length: 259 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13517
95 % 3 7 13358
90 % 3 7 13213
70 % 3 7 12466
50 % 3 7 11341
40 % 3 7 10668
30 % 3 7 9838
Entity #32 | Chains: CR,CS
Kre33 protein, length: 1073 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 8 4427
95 % 3 8 5290
90 % 3 8 5358
70 % 3 8 5340
50 % 11 16 2618
40 % 11 16 2616
30 % 11 16 2606
Entity #33 | Chains: CT
Fcf2 protein, length: 203 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 14231
95 % 3 7 13610
90 % 3 7 13425
70 % 3 7 12652
50 % 3 7 11543
40 % 3 7 10828
30 % 3 7 10000
Entity #34 | Chains: Ca
40S ribosomal protein S1 protein, length: 255 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 5 19332
95 % 3 5 18094
90 % 3 5 17740
70 % 70 110 424
50 % 72 116 440
40 % 101 197 293
30 % 101 197 307
Entity #35 | Chains: Cb
40S ribosomal protein S4 protein, length: 264 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 5 21475
95 % 2 5 19131
90 % 2 5 18710
70 % 100 218 239
50 % 102 228 235
40 % 102 232 236
30 % 109 244 227
Entity #36 | Chains: Cc
40S ribosomal protein s5-like protein protein, length: 212 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 14230
95 % 3 7 13609
90 % 3 7 13424
70 % 33 118 535
50 % 105 239 219
40 % 105 239 225
30 % 105 239 233
Entity #37 | Chains: Cd
40S ribosomal protein S6 protein, length: 239 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 5 19331
95 % 2 5 18093
90 % 2 5 17739
70 % 32 108 578
50 % 101 219 252
40 % 101 224 250
30 % 101 224 258
Entity #38 | Chains: Ce
40S ribosomal protein S7 protein, length: 203 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 14271
95 % 3 7 13697
90 % 3 7 13517
70 % 3 7 12729
50 % 102 226 243
40 % 102 226 245
30 % 104 229 246
Entity #39 | Chains: Cf
40S ribosomal protein S8 protein, length: 202 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 5 21345
95 % 2 5 19347
90 % 2 5 18899
70 % 70 113 413
50 % 102 227 236
40 % 102 231 237
30 % 102 231 244
Entity #4 | Chains: UD
Utp4 protein, length: 884 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 4 8 10385
95 % 4 8 10853
90 % 4 8 10762
70 % 4 8 10357
50 % 4 8 9628
40 % 4 8 9184
30 % 4 8 8568
Entity #40 | Chains: Cg
40S ribosomal protein s9-like protein protein, length: 190 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 14270
95 % 3 7 13696
90 % 3 7 13516
70 % 103 223 234
50 % 105 238 223
40 % 112 249 217
30 % 112 249 223
Entity #41 | Chains: Ch
40S ribosomal protein S13-like protein protein, length: 151 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 14311
95 % 3 7 13770
90 % 3 7 13587
70 % 103 232 227
50 % 105 235 231
40 % 112 247 218
30 % 112 247 224
Entity #42 | Chains: Ci
40S ribosomal protein S14-like protein protein, length: 150 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 14363
95 % 3 7 13873
90 % 33 99 650
70 % 105 236 218
50 % 105 237 226
40 % 105 237 228
30 % 105 237 235
Entity #43 | Chains: Cj
40S ribosomal protein S16-like protein protein, length: 143 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 14272
95 % 3 7 13698
90 % 3 7 13518
70 % 3 7 12730
50 % 103 228 234
40 % 110 239 227
30 % 110 240 230
Entity #44 | Chains: Ck
40S ribosomal protein S11-like protein protein, length: 161 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 5 20197
95 % 2 5 19499
90 % 2 5 19174
70 % 71 115 396
50 % 103 234 232
40 % 103 234 233
30 % 103 234 241
Entity #45 | Chains: Cm
40S ribosomal protein S22-like protein protein, length: 130 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13866
95 % 3 7 14090
90 % 3 7 13897
70 % 103 238 220
50 % 105 240 222
40 % 113 252 213
30 % 552 896 20
Entity #46 | Chains: Cn
40S ribosomal protein s23-like protein protein, length: 145 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 14338
95 % 3 7 13680
90 % 3 7 13492
70 % 105 242 211
50 % 112 255 204
40 % 112 255 210
30 % 112 255 220
Entity #47 | Chains: Co
40S ribosomal protein S24 protein, length: 136 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 5 20269
95 % 2 5 19500
90 % 2 5 19059
70 % 70 115 401
50 % 100 229 238
40 % 100 229 240
30 % 100 229 250
Entity #48 | Chains: Cp
40S ribosomal protein S28-like protein protein, length: 68 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 14364
95 % 3 7 14207
90 % 3 7 13691
70 % 103 229 229
50 % 112 243 214
40 % 112 244 219
30 % 112 244 226
Entity #49 | Chains: CU
Faf1 protein, length: 311 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 14643
95 % 3 7 14447
90 % 3 7 14230
70 % 3 7 13388
50 % 3 7 12218
40 % 3 7 11454
30 % 3 7 10553
Entity #5 | Chains: UF
Utp6 protein, length: 414 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 14142
95 % 3 7 13458
90 % 3 7 13277
70 % 3 7 12525
50 % 3 7 11416
40 % 3 7 10712
30 % 3 7 9904
Entity #50 | Chains: C1
35S ribosomal RNA rna, length: 2352 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
Entity #51 | Chains: C2
U3 snoRNA rna, length: 230 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
Entity #52 | Chains: UV
U3 small nucleolar RNA-associated protein 22 protein, length: 1171 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 4 27179
95 % 1 4 27505
90 % 1 4 26569
70 % 1 4 24132
50 % 1 4 21166
40 % 1 4 19359
30 % 1 4 17345
Entity #53 | Chains: CV
Rrp7 protein, length: 322 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 4 29340
95 % 1 4 23223
90 % 1 4 22609
70 % 1 4 23610
50 % 1 4 20752
40 % 1 4 16849
30 % 1 4 15223
Entity #54 | Chains: CW
Ribosome biogenesis protein ENP2 protein, length: 668 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 4 32214
95 % 2 4 25089
90 % 2 4 24324
70 % 2 4 22143
50 % 2 4 19529
40 % 2 4 17904
30 % 2 4 17163
Entity #55 | Chains: UT
Utp20 protein, length: 2612 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 4 30336
95 % 2 4 24149
90 % 2 4 23883
70 % 2 4 21751
50 % 2 4 18935
40 % 2 4 17614
30 % 2 4 15894
Entity #56 | Chains: UH
Utp8 protein, length: 930 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 6 16982
95 % 3 6 18063
90 % 3 6 17708
70 % 3 6 16302
50 % 3 6 14781
40 % 3 6 13711
30 % 3 6 12495
Entity #57 | Chains: UE,UI
Utp5 protein, length: 410 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 6 7768
95 % 3 6 8365
90 % 3 6 8337
70 % 3 6 8115
50 % 3 6 7455
40 % 3 6 7350
30 % 3 6 6910
Entity #58 | Chains: US
Noc4 protein, length: 549 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 6 18374
95 % 3 6 15811
90 % 3 6 16362
70 % 3 6 15258
50 % 3 6 13230
40 % 3 6 12856
30 % 3 6 11157
Entity #59 | Chains: Cl
Rps18 protein, length: 156 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 6 18112
95 % 3 6 16536
90 % 3 6 16225
70 % 98 215 241
50 % 100 224 239
40 % 107 236 230
30 % 107 237 237
Entity #6 | Chains: UG
Utp7 protein, length: 558 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 14266
95 % 3 7 13689
90 % 3 7 13505
70 % 3 7 12714
50 % 3 7 11603
40 % 15 21 4019
30 % 15 21 3932
Entity #60 | Chains: CX
Enp1 protein, length: 480 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 6 17051
95 % 3 6 14627
90 % 3 6 14417
70 % 3 6 13569
50 % 3 6 12389
40 % 3 6 11610
30 % 18 29 2808
Entity #61 | Chains: CY
U3 small nucleolar ribonucleoprotein protein lcp5-like protein protein, length: 381 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 3 36066
95 % 2 3 28364
90 % 2 3 26741
70 % 2 3 24273
50 % 2 3 21300
40 % 2 3 19472
30 % 2 3 17454
Entity #62 | Chains: CZ
Bfr2 protein, length: 609 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 4 30337
95 % 2 4 25334
90 % 2 4 24559
70 % 2 4 21752
50 % 2 4 19215
40 % 2 4 17615
30 % 2 4 15895
Entity #63 | Chains: UP
Utp16 protein, length: 364 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 6 16728
95 % 3 6 17709
90 % 3 6 15936
70 % 3 6 16113
50 % 3 6 14515
40 % 3 6 13490
30 % 3 6 12304
Entity #7 | Chains: UJ
UTP10 protein, length: 1802 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 8 13427
95 % 3 8 13232
90 % 3 8 12494
70 % 3 8 12327
50 % 3 8 11243
40 % 3 8 10564
30 % 3 8 9768
Entity #8 | Chains: UK
U3 small nucleolar RNA-associated protein 11 protein, length: 270 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 14008
95 % 3 7 14382
90 % 3 7 14166
70 % 3 7 13324
50 % 3 7 12164
40 % 3 7 11407
30 % 3 7 10515
Entity #9 | Chains: UL
Utp12 protein, length: 962 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 14687
95 % 3 7 14503
90 % 3 7 14300
70 % 3 7 13445
50 % 3 7 12278
40 % 17 25 3302
30 % 17 25 3237

Instructions

In the table for each entity, view a list of similar sequences by selecting the link associated with the percentage cutoff.



View more detailed documentation on the redundancy reduction and sequence clustering procedure used by RCSB PDB.

You can also use the structure comparison tool to compare any 2 given structures


ACTION - (A) Select for download / view details OR (B) Select two chains for comparison
Rank PDB ID Entity ID Chains Description Details Taxonomy EC Number
1 1SEI 1 A, B RIBOSOMAL PROTEIN S8 1422
2 4YBB 8 AH, BH 30S ribosomal protein S8 562
3 4Y4O 39 1h, 2h 30S ribosomal protein S8 274
4 5J8B 41 h 30S ribosomal protein S8 274
5 1AN7 1 A, B RIBOSOMAL PROTEIN S8 274
6 4W2F 8 AH, CH 30S Ribosomal Protein S8 274
7 6CFL 39 1h, 2h 30S Ribosomal Protein S8 274
8 6CAE 39 1h, 2h 30S ribosomal protein S8 274
9 4Y4P 39 1h, 2h 30S ribosomal protein S8 274
10 1I6U 2 A, B 30S RIBOSOMAL PROTEIN S8P 2190
11 5FDV 40 1h, 2h 30S ribosomal protein S8 274
12 5J4B 39 1h, 2h 30S ribosomal protein S8 274
13 4W2G 8 AH, CH 30S Ribosomal Protein S8 274
14 6CFK 39 1h, 2h 30S ribosomal protein S8 274
15 5J7L 8 AH, BH 30S ribosomal protein S8 562
16 5W4K 39 1h, 2h 30S ribosomal protein S8 274
17 4LFB 8 H ribosomal protein S8 274
18 1VY4 8 AH, CH 30S ribosomal protein S8 274
19 4WOI 8 AH, DH 30S ribosomal protein S8 562
20 5FDU 39 1h, 2h 30S ribosomal protein S8 274
21 6I7V 12 AH, BH 30S ribosomal protein S8 562
22 4W2I 8 AH, CH 30S Ribosomal Protein S8 274
23 5JC9 8 AH, BH 30S ribosomal protein S8 562
24 1VY5 8 AH, CH 30S ribosomal protein S8 274
25 5HCQ 39 1h, 2h 30S ribosomal protein S8 274
26 4WQF 41 BH, DH 30S ribosomal protein S8 274
27 6ND5 39 1h, 2h 30S ribosomal protein S8 274
28 4W2H 8 AH, CH 30S Ribosomal Protein S8 274
29 4WPO 41 BH, DH 30S ribosomal protein S8 274
30 5J8A 8 AH, BH 30S ribosomal protein S8 562
31 4V8I 8 AH, CH 30S Ribosomal Protein S8 274
32 4JI1 8 H RIBOSOMAL PROTEIN S8 274
33 4V88 24 AW, CW 40S ribosomal protein S22-A 4932
34 4Z3S 39 1h, 2h 30S ribosomal protein S8 274
35 5DOY 39 1h, 2h 30S Ribosomal Protein S8 274
36 5J5B 8 AH, BH 30S ribosomal protein S8 562
37 5HD1 39 1h, 2h 30S ribosomal protein S8 274
38 4U4R 24 D2, d2 40S ribosomal protein S22-A 4932
39 4DR6 8 H 30S ribosomal protein S8 274
40 4LF7 8 H ribosomal protein S8 274
41 4LF8 8 H ribosomal protein S8 274
42 5WIS 39 1h, 2h 30S ribosomal protein S8 274
43 4WSD 8 72, 7E 30S ribosomal protein S8 274
44 4WQU 41 BH, DH 30S ribosomal protein S8 274
45 5WIT 39 1h, 2h 30S ribosomal protein S8 274
46 5E81 8 72, 7E 30S ribosomal protein S8 274
47 2VQE 8 H 30S RIBOSOMAL PROTEIN S8 274
48 6GSJ 8 72, 7E 30S ribosomal protein S8 274
49 4U27 8 AH, CH 30S ribosomal protein S8 562
50 6OF1 39 1h, 2h 30S ribosomal protein S8 274
51 6CFJ 39 1h, 2h 30S ribosomal protein S8 274
52 4U3U 24 D2, d2 40S ribosomal protein S22-A 4932
53 4Z8C 39 1h, 2h 30S ribosomal protein S8 274
54 5HCR 39 1h, 2h 30S ribosomal protein S8 274
55 5TBW 71 X, d2 40S ribosomal protein S22-A 4932
56 2UUB 8 H 30S RIBOSOMAL PROTEIN S8 274
57 4DV6 8 H ribosomal protein S8 274
58 4JYA 8 H 30S ribosomal protein S8 274
59 5IBB 8 72, 7E 30S ribosomal protein S8 274
60 4DR5 8 H 30S ribosomal protein S8 274
61 5J4C 39 1h, 2h 30S ribosomal protein S8 274
62 4KHP 8 H 30S Ribosomal protein S8 274
63 4DR2 8 H 30S ribosomal protein S8 274
64 4WRO 12 7E 30S ribosomal protein S8 274
65 4WQ1 8 72, 7E 30S ribosomal protein S8 274
66 4LF9 8 H ribosomal protein S8 274
67 4WQY 41 BH, DH 30S ribosomal protein S8 274
68 4DUY 8 H ribosomal protein S8 274
69 4U3M 24 D2, d2 40S ribosomal protein S22-A 4932
70 4DV7 8 H ribosomal protein S8 274
71 4WRA 8 72, 7E 30S ribosomal protein S8 274
72 1S03 2 G, H 30S ribosomal protein S8 562
73 5IB7 8 72, 7E 30S ribosomal protein S8 274
74 4U26 8 AH, CH 30S ribosomal protein S8 562
75 4X64 8 H 30S ribosomal protein S8 274
76 5HCP 39 1h, 2h 30S ribosomal protein S8 274
77 5IT8 8 AH, BH 30S ribosomal protein S8 562
78 4V9D 8 AH, BH 30S ribosomal protein S8 562
79 4V9P 40 BH, DH, FH, HH 30S ribosomal protein S8 562
80 4V9H 21 AH 30S ribosomal protein S8 274
81 4U3N 24 D2, d2 40S ribosomal protein S22-A 4932
82 6XQD 39 1h, 2h 30S ribosomal protein S8 274
83 5J91 8 AH, BH 30S ribosomal protein S8 562
84 4V8D 8 AK, CK 30S RIBOSOMAL PROTEIN S8 274
85 5WNT 8 H RIBOSOMAL PROTEIN S8 274
86 4DR3 8 H 30S ribosomal protein S8 274
87 4V90 8 AH 30S RIBOSOMAL PROTEIN S8 274
88 4JI3 8 H RIBOSOMAL PROTEIN S8 274
89 4WQR 8 72, 7E 30S ribosomal protein S8 274
90 4JI6 8 H RIBOSOMAL PROTEIN S8 274
91 4JI8 8 H RIBOSOMAL PROTEIN S8 274
92 2UXC 8 H RIBOSOMAL PROTEIN S8 274
93 5IB8 8 72, 7E 30S ribosomal protein S8 274
94 4V9R 8 AH, CH 30S Ribosomal Protein S8 274
95 4B3M 8 H 30S RIBOSOMAL PROTEIN S8 274
96 5EL6 8 72, 7E 30S ribosomal protein S8 274
97 6O97 39 1h, 2h 30S ribosomal protein S8 274
98 5EL7 8 72, 7E 30S ribosomal protein S8 274
99 5VP2 39 1h, 2h 30S ribosomal protein S8 274
100 4U52 24 D2, d2 40S ribosomal protein S22-A 4932
101 4LF4 8 H ribosomal protein S8 274
102 5DFE 42 QH, XH 30S ribosomal protein S8 274
103 5NDK 50 72, 7E 30S ribosomal protein S8 274
104 4LF6 8 H ribosomal protein S8 274
105 4JI7 8 H RIBOSOMAL PROTEIN S8 274
106 5J88 8 AH, BH 30S ribosomal protein S8 562
107 4U24 8 AH, CH 30S ribosomal protein S8 562
108 4WU1 8 72, 7E 30S ribosomal protein S8 274
109 4U4Q 24 D2, d2 40S ribosomal protein S22-A 4932
110 6QNR 8 72, 7E 30S ribosomal protein S8 274
111 5EL4 8 72, 7E 30S ribosomal protein S8 274
112 5WNV 8 H 30S ribosomal protein S8 274
113 4U6F 24 D2, d2 40S ribosomal protein S22-A 4932
114 4B3T 8 H 30S RIBOSOMAL PROTEIN S8 274
115 4WR6 8 72, 7E 30S ribosomal protein S8 274
116 4V8B 8 AK, CK 30S RIBOSOMAL PROTEIN S8 274
117 5HAU 41 1h, 2h 30S ribosomal protein S8 274
118 4V9O 41 BH, DH, FH, HH 30S ribosomal protein S8 562
119 6MPF 8 H 30S ribosomal protein S8 274
120 2VQF 8 H 30S RIBOSOMAL PROTEIN S8 274
121 2UUA 8 H 30S RIBOSOMAL PROTEIN S8 274
122 4V87 38 BK, CK 30S RIBOSOMAL PROTEIN S8 274
123 4WF1 8 AH, CH 30S ribosomal protein S8 562
124 4U25 8 AH, CH 30S ribosomal protein S8 562
125 4V95 8 AH, CH 30S Ribosomal Protein S8 274
126 4WWW 39 QH, XH 30S ribosomal protein S8 562
127 4V7T 8 AH, CH 30S ribosomal protein S8 562
128 1VY7 8 AH, CH 30S ribosomal protein S8 274
129 4U4U 24 D2, d2 40S ribosomal protein S22-A 4932
130 5E7K 8 72, 7E 30S ribosomal protein S8 274
131 4U4Z 24 D2, d2 40S ribosomal protein S22-A 4932
132 5EL5 8 72, 7E 30S ribosomal protein S8 274
133 6FKR 39 1h, 2h 30S ribosomal protein S8 274
134 4B3R 8 H 30S RIBOSOMAL PROTEIN S8 274
135 4LNT 8 QH, XH 30S ribosomal protein S8 274
136 4U4Y 24 D2, d2 40S ribosomal protein S22-A 4932
137 4DR1 8 H 30S ribosomal protein S8 274
138 4LFA 8 H ribosomal protein S8 274
139 4U4N 24 D2, d2 40S ribosomal protein S22-A 4932
140 4DV4 8 H ribosomal protein S8 274
141 4U55 24 D2, d2 40S ribosomal protein S22-A 4932
142 4YZV 8 QH, XH 30S ribosomal protein S8 274
143 4JI0 8 H ribosomal protein S8 274
144 5IWA 7 H 30S ribosomal protein S8 274
145 4V7U 8 AH, CH 30S ribosomal protein S8 562
146 4V9S 8 AH, CH 30S Ribosomal Protein S8 274
147 4JI2 8 H RIBOSOMAL PROTEIN S8 274
148 4V6C 7 AH, CH 30S ribosomal protein S8 562
149 4JV5 8 H 30S ribosomal protein S8 274
150 4DR7 8 H 30S ribosomal protein S8 274
151 1J5E 8 H 30S RIBOSOMAL PROTEIN S8 274
152 6OF6 8 QH, XH 30S ribosomal protein S8 274
153 4GKK 8 H 30S ribosomal protein S8 274
154 4DUZ 8 H ribosomal protein S8 274
155 5NDJ 50 72, 7E 30S ribosomal protein S8 274
156 4V7V 8 AH, CH 30S ribosomal protein S8 562
157 4X65 8 H 30S ribosomal protein S8 274
158 4V8G 8 AH, CH 30S Ribosomal Protein S8 274
159 4GKJ 8 H 30S ribosomal protein S8 274
160 4DV3 8 H ribosomal protein S8 274
161 4V7S 8 AH, CH 30S ribosomal protein S8 562
162 4DV5 8 H ribosomal protein S8 274
163 5DAT 24 D2 40S ribosomal protein S22-A 4932
164 5DAT 80 d2 40S ribosomal protein S22-A 4932
165 6LKQ 7 G 30S ribosomal protein S8 562
166 2UUC 8 H 30S RIBOSOMAL PROTEIN S8 274
167 4LFC 8 H ribosomal protein S8 274
168 1FJG 9 H 30S RIBOSOMAL PROTEIN S8 274
169 3T1Y 8 H 30S ribosomal protein S8 274
170 4WZO 8 72, 7E 30S ribosomal protein S8 274
171 4JI4 8 H RIBOSOMAL PROTEIN S8 274
172 1VY6 8 AH, CH 30S ribosomal protein S8 274
173 1XMQ 10 H 30S Ribosomal Protein S8 274
174 5WNP 8 H 30S ribosomal protein S8 274
175 6CAP 8 H 30S ribosomal protein S8 274
176 4U20 8 AH, CH 30S ribosomal protein S8 562
177 6MPI 8 H 30S ribosomal protein S8 274
178 5I4L 24 D2, d2 40S ribosomal protein S22-A 4932
179 4DV0 8 H ribosomal protein S8 274
180 4V9B 8 AK, CK 30S RIBOSOMAL PROTEIN S8 274
181 4U1V 8 AH, CH 30S ribosomal protein S8 562
182 4V6F 38 BK, CK 30S ribosomal protein S8 274
183 4X62 8 H 30S ribosomal protein S8 274
184 4V8F 38 BK, CK 30S RIBOSOMAL PROTEIN S8 274
185 4U51 24 D2, d2 40S ribosomal protein S22-A 4932
186 4B3S 8 H 30S RIBOSOMAL PROTEIN S8 274
187 4DV2 8 H ribosomal protein S8 274
188 4DV1 8 H ribosomal protein S8 274
189 5WNU 8 H 30S ribosomal protein S8 274
190 1N32 10 H 30S RIBOSOMAL PROTEIN S8 274
191 5F8K 39 1h, 2h 30S ribosomal protein S8 274
192 1I94 8 H 30S RIBOSOMAL PROTEIN S8 274
193 6HHQ 70 X, d2 40S ribosomal protein S22-A 4932
194 4V8H 8 AH, CH 30S Ribosomal Protein S8 274
195 7JQL 39 1h, 2h 30S ribosomal protein S8 274
196 5OBM 68 D2, d2 40S ribosomal protein S22-A 4932
197 4JI5 8 H RIBOSOMAL PROTEIN S8 274
198 6CAQ 8 H 30S ribosomal protein S8 274
199 4K0K 8 H 30S ribosomal protein S8 274
200 4W2E 41 h 30S ribosomal protein S8 274
201 4V8C 38 CK, DK 30S RIBOSOMAL PROTEIN S8 274
202 5BR8 8 H 30S ribosomal protein S8 274
203 4LF5 8 H ribosomal protein S8 274
204 5J4D 42 QA, VC 30S ribosomal protein S8 274
205 4V9A 8 AK, CK 30S RIBOSOMAL PROTEIN S8 274
206 4U53 24 D2, d2 40S ribosomal protein S22-A 4932
207 5ON6 72 X, d2 40S ribosomal protein S22-A 4932
208 4V5J 8 AH, CH 30S RIBOSOMAL PROTEIN S8 274
209 4U50 24 D2, d2 40S ribosomal protein S22-A 4932
210 5NDV 68 D2, d2 40S ribosomal protein S22-A 4932
211 5LYB 24 D2, d2 40S ribosomal protein S22-A 4932
212 6ND6 39 1h, 2h 30S ribosomal protein S8 274
213 4V7Y 8 AH, CH 30S ribosomal protein S8 274
214 7JQM 39 1h, 2h 30S ribosomal protein S8 274
215 6UO1 39 1h, 2h 30S ribosomal protein S8 274
216 6GSK 8 72, 7E 30S ribosomal protein S8 274
217 4V9C 8 AH, CH 30S ribosomal protein S8 562
218 4V8E 38 BK, DK 30S RIBOSOMAL PROTEIN S8 274
219 5J30 39 QH, XH 30S ribosomal protein S8 274
220 6QNQ 8 72, 7E 30S ribosomal protein S8 274
221 4DR4 8 H 30S ribosomal protein S8 274
222 4WZD 8 72, 7E 30S ribosomal protein S8 274
223 6OPE 8 QH, XH 30S ribosomal protein S8 274
224 3OTO 8 H 30S RIBOSOMAL PROTEIN S8 274
225 4X66 8 H 30S ribosomal protein S8 274
226 2UU9 8 H 30S RIBOSOMAL PROTEIN S8 274
227 4V8Q 42 BH 30S RIBOSOMAL PROTEIN S8 274
228 4U56 24 D2, d2 40S ribosomal protein S22-A 4932
229 4V85 8 AH 30S ribosomal protein S8 562
230 1HR0 9 H 30S RIBOSOMAL PROTEIN S8 274
231 4AQY 8 H 30S RIBOSOMAL PROTEIN S8 274
232 4W4G 8 QH, XH 30S ribosomal protein S8 274
233 4NXM 8 H ribosomal protein S8 274
234 4V5L 8 AH 30S RIBOSOMAL PROTEIN S8 274
235 4YPB 8 QH, XH 30S ribosomal protein S8 274
236 4V7X 8 AH, CH 30S ribosomal protein S8 274
237 5TGA 24 D2, d2 40S ribosomal protein S22-A 4932
238 4U1U 8 AH, CH 30S ribosomal protein S8 562
239 4ZER 39 1h, 2h 30S ribosomal protein S8 274
240 1IBL 11 H 30S RIBOSOMAL PROTEIN S8 274
241 5MEI 71 X, d2 40S ribosomal protein S22-A 4932
242 6ORD 8 QH, XH 30S ribosomal protein S8 274
243 4V7W 8 AH, CH 30S ribosomal protein S8 274
244 4WT1 8 72, 7E 30S ribosomal protein S8 274
245 6C5L 8 AH, CH 30S ribosomal protein S8 274
246 4WT8 8 AH, BH 30S ribosomal protein S8 274
247 5DOX 39 1h, 2h 30S ribosomal protein S8 274
248 6OTR 8 QH, XH 30S ribosomal protein S8 274
249 4NXN 8 H ribosomal protein S8 274
250 1XNR 10 H 16S Ribosomal protein S8 274
251 4LT8 8 QH, XH 30S ribosomal protein S8 274
252 5FCJ 24 D2, d2 40S ribosomal protein S22-A 4932
253 5WNQ 8 H 30S ribosomal protein S8 274
254 4U4O 24 D2, d2 40S ribosomal protein S22-A 4932
255 6MKN 8 H 30S ribosomal protein S8 274
256 4V51 8 AH, CH 30S RIBOSOMAL PROTEIN S8 274
257 6DTI 8 H 30S ribosomal protein S8 274
258 4V7L 8 AH, CH 30S ribosomal protein S8 274
259 4V5R 8 AH, CH 30S RIBOSOMAL PROTEIN S8 274
260 1HNZ 9 H 30S RIBOSOMAL PROTEIN S8 274
261 1XNQ 10 H Ribosomal protein S8 274
262 4V8A 38 CH, DH 30S ribosomal protein S8 274
263 4V5K 8 AH, CH 30S RIBOSOMAL PROTEIN S8 274
264 4V5Q 8 AH, CH 30S RIBOSOMAL PROTEIN S8 274
265 4V7J 7 Ah, Bh 30S ribosomal protein S8 274
266 6XQE 39 1h, 2h 30S ribosomal protein S8 274
267 5DGV 24 D2, d2 40S ribosomal protein S22-A 4932
268 6BZ6 8 QH, XH 30S ribosomal protein S8 274
269 5DGE 24 D2, d2 40S ribosomal protein S22-A 4932
270 5J3C 39 QH, XH 30S ribosomal protein S8 274
271 4V5C 8 AH, CH 30S RIBOSOMAL PROTEIN S8 274
272 4V5E 8 AH, CH 30S RIBOSOMAL PROTEIN S8 274
273 4L47 8 QH, XH 30S ribosomal protein S8 274
274 4V5P 8 AH, CH 30S RIBOSOMAL PROTEIN S8 274
275 5V8I 39 1h, 2h 30S ribosomal protein S8 274
276 4ZSN 8 QH, XH 30S ribosomal protein S8 274
277 4V5D 8 AH, CH 30S RIBOSOMAL PROTEIN S8 274
278 5NDW 17 D2, d2 40S ribosomal protein S22-A 4932
279 6CZR 39 1h, 2h 30S ribosomal protein S8 274
280 6OXA 8 QH, XH 30S ribosomal protein S8 274
281 6BUW 8 QH, XH 30S ribosomal protein S8 274
282 4V7Z 8 AH, CH 30S ribosomal protein S8 274
283 4V8X 8 AH, CH 30S RIBOSOMAL PROTEIN S8 274
284 4V5S 8 AH, CH 30S RIBOSOMAL PROTEIN S8 274
285 4V9I 8 AH, CH 30S Ribosomal protein S8 274
286 1XMO 10 H 30S ribosomal protein S8 274
287 3T1H 8 H 30S ribosomal protein S8 274
288 2UXD 8 H RIBOSOMAL PROTEIN S8 274
289 6OJ2 8 QH, XH 30S ribosomal protein S8 274
290 1N33 10 H 30S RIBOSOMAL PROTEIN S8 274
291 1IBK 9 H 30S RIBOSOMAL PROTEIN S8 274
292 4V6G 8 AK, CK 30S RIBOSOMAL PROTEIN S8 274
293 4V8N 8 AH, CH 30S RIBOSOMAL PROTEIN S8 274
294 4V97 8 AH, CH 30S ribosomal protein S8 274
295 6CAR 8 H 30S ribosomal protein S8 274
296 1HNW 9 H 30S RIBOSOMAL PROTEIN S8 274
297 4V7M 8 AH, CH 30S ribosomal protein S8 274
298 4WSM 8 72, 7E 30S ribosomal protein S8 274
299 4TUD 8 QH, XH 30S ribosomal protein S8 274
300 1IBM 11 H 30S RIBOSOMAL PROTEIN S8 274
301 5WNR 8 H 30S ribosomal protein S8 274
302 6CAO 8 H 30S ribosomal protein S8 274
303 4V6A 8 AH, CH 30S ribosomal protein S8 274
304 4TUE 8 QH, XH 30S ribosomal protein S8 274
305 6OXI 8 QH, XH 30S ribosomal protein S8 274
306 4TUA 8 QH, XH 30S ribosomal protein S8 274
307 4BTS 18 AH, BH, CH, DH 40S RIBOSOMAL PROTEIN RPS22E 5911
308 4V84 8 AH, CH 30S ribosomal protein S8 274
309 5WNS 8 H 30S ribosomal protein S8 274
310 6NDK 8 QH, XH 30S ribosomal protein S8 274
311 4V7K 7 Ah, Bh 30S ribosomal protein S8 274
312 4YY3 8 H 30S ribosomal protein S8 274
313 1HNX 9 H 30S RIBOSOMAL PROTEIN S8 274
314 4V9Q 38 BH, DH 30S ribosomal protein S8 274
315 6BZ8 8 QH, XH 30S ribosomal protein S8 274
316 4TUC 8 QH, XH 30S ribosomal protein S8 274
317 4YHH 8 H 30S ribosomal protein S8 274
318 5VPO 9 QH, XH 30S ribosomal protein S8 274
319 6NY6 8 H 30S ribosomal protein S8 274
320 5NDG 24 D2, d2 40S ribosomal protein S22-A 4932
321 4TUB 8 QH, XH 30S ribosomal protein S8 274
322 4V9N 11 AH, CH 30S ribosomal protein S8 274
323 5FCI 24 D2, d2 40S ribosomal protein S22-A 4932
324 4P70 8 QH, XH 30S ribosomal protein S8 274
325 4V8U 8 AH, CH 30S RIBOSOMAL PROTEIN S8 274
326 4LSK 8 QH, XH 30S ribosomal protein S8 274
327 5DC3 24 D2, d2 40S ribosomal protein S22-A 4932
328 4V6D 7 AH, CH 30S ribosomal protein S8 562
329 4P6F 8 QH, XH 30S ribosomal protein S8 274
330 4V67 10 AH, CH 30S ribosomal protein S8 274
331 4V83 8 AH, CH 30S ribosomal protein S8 274
332 5DGF 24 D2, d2 40S ribosomal protein S22-A 4932
333 4V5F 8 AH, CH 30S RIBOSOMAL PROTEIN S8 274
334 4V5O 17 AH, BH RIBOSOMAL PROTEIN S8 CONTAINING PROTEIN 5911
335 1VVJ 8 QH, XH 30S ribosomal protein S8 274
336 4LFZ 8 QH, XH 30S ribosomal protein S8 274
337 2E5L 9 H 30S ribosomal protein S8 274
338 6BZ7 8 QH, XH 30S ribosomal protein S8 274
339 6N1D 42 AS08, BS08 30S ribosomal protein S8 274
340 4V6E 7 AH, CH 30S ribosomal protein S8 562
341 6UCQ 38 1h, 2h 30S ribosomal protein S8 274
342 6CAS 8 H 30S ribosomal protein S8 274
343 4V52 7 AH, CH 30S ribosomal protein S8 562
344 5CZP 39 QH, XH 30S ribosomal protein S8 274
345 6N9F 39 1h, 2h 30S Ribosomal Protein S8 274
346 6N9E 39 1h, 2h 30S Ribosomal Protein S8 274
347 2HHH 8 H 30S ribosomal protein S8 274
348 4V89 8 AH 30S ribosomal protein S8 562
349 4OX9 8 H 30S ribosomal protein S8 274
350 4V54 7 AH, CH 30S ribosomal protein S8 562
351 2UXB 8 H RIBOSOMAL PROTEIN S8 274
352 1I96 8 H 30S RIBOSOMAL PROTEIN S8 274
353 5TGM 24 D2, d2 40S ribosomal protein S22-A 4932
354 4V9K 7 AH, CH 30S ribosomal protein S8 274
355 4V50 10 AH, CH 30S ribosomal protein S8 562
356 1N34 9 H 30S RIBOSOMAL PROTEIN S8 274
357 4V57 7 AH, CH 30S ribosomal protein S8 562
358 4V5A 8 AH, CH 30S RIBOSOMAL PROTEIN S8 274
359 4V63 10 AH, CH 30S ribosomal protein S8 274
360 4L71 8 QH, XH 30S ribosomal protein S8 274
361 4KVB 8 H 30S ribosomal protein S8 274
362 4XEJ 35 AS08, BS08 30S ribosomal protein S8 274
363 4V64 7 AH, CH 30S ribosomal protein S8 562
364 4V7P 8 AH, DH 30S ribosomal protein S8 274
365 4V8J 8 AH, CH 30S ribosomal protein S8 274
366 1N36 8 H 30S RIBOSOMAL PROTEIN S8 274
367 2ZM6 8 H 30S ribosomal protein S8 274
368 4V4H 7 AH, CH 30S RIBOSOMAL PROTEIN S8 562
369 4V4Q 7 AH, CH 30S ribosomal protein S8 562
370 4V5B 40 BH, DH 30S RIBOSOMAL PROTEIN S8 RESIDUES 2-130 562
371 5D8B 35 EC, IA 30S ribosomal protein S8 274
372 6BY1 43 AH, BH 30S ribosomal protein S8 562
373 4LEL 8 QH, XH 30S ribosomal protein S8 274
374 4V53 7 AH, CH 30S ribosomal protein S8 562
375 2F4V 9 H 30S ribosomal protein S8 274
376 4V9L 7 AH, CH 30S ribosomal protein S8 274
377 1FKA 8 H 30S RIBOSOMAL PROTEIN S8 274
378 4V5G 8 AH, CH 30S RIBOSOMAL PROTEIN S8 274
379 4V56 7 AH, CH 30S ribosomal protein S8 562
380 1I97 8 H 30S RIBOSOMAL PROTEIN S8 274
381 4V9J 7 AH, CH 30S ribosomal protein S8 274
382 4V55 7 AH, CH 30S ribosomal protein S8 562
383 1I95 8 H 30S RIBOSOMAL PROTEIN S8 274
384 4V8O 8 AH 30S RIBOSOMAL PROTEIN S8 274
385 4V7R 16 AO, CO 40S ribosomal protein S22-A 4932
386 4V9M 7 AH, CH 30S ribosomal protein S8 274
387 4W29 7 AH, CH 30S ribosomal protein S8 274
388 4V5Y 7 AH, CH 30S ribosomal protein S8 562
389 4V4Y 10 AK 30S ribosomal protein S8 274
390 4V4J 41 i 30S ribosomal protein S8 274
391 4V4X 10 AK 30S ribosomal protein S8 274
392 4V4Z 11 AK 30S ribosomal protein S8 274
393 4V4I 41 i 30S ribosomal protein S8 274
394 4V4P 43 BK 30S ribosomal protein S8 274
395 5VYC 16 W1, W2, W3, W4, W5, W6 40S ribosomal protein S15a 9606
396 4V4R 11 AH 30S ribosomal protein S8 274
397 4V4S 11 AH 30S ribosomal protein S8 274
398 4V4T 11 AH 30S ribosomal protein S8 274
399 4KZZ 23 W 40S Ribosomal Protein S15A 9986
400 4KZX 23 W 40S ribosomal protein S15A 9986
401 4KZY 23 W 40S Ribosomal Protein S15A 9986
402 4V49 10 AH 30S ribosomal protein S8 562
403 4V4A 8 AH 30S ribosomal protein S8 562
404 7K00 8 H 30S ribosomal protein S8 562
405 6ZVH 29 W 40S ribosomal protein S15a 9606
406 6ZVI 26 E RPS22A isoform 1 4932
407 6ZU1 8 AH 30S ribosomal protein S8 562
408 6ZTJ 8 AH 30S ribosomal protein S8 562
409 6ZTL 8 AH 30S ribosomal protein S8 562
410 6ZTM 8 AH 30S ribosomal protein S8 562
411 6ZTN 8 AH 30S ribosomal protein S8 562
412 6ZTO 8 AH 30S ribosomal protein S8 562
413 6ZTP 8 AH 30S ribosomal protein S8 562
414 6ZQA 51 DW 40S ribosomal protein S22-A 4932
415 6ZQB 60 DW 40S ribosomal protein S22-A 4932
416 6ZQC 60 DW 40S ribosomal protein S22-A 4932
417 6ZQD 57 DW 40S ribosomal protein S22-A 4932
418 6ZQE 53 DW 40S ribosomal protein S22-A 4932
419 6ZQF 37 DW 40S ribosomal protein S22-A 4932
420 6ZQG 29 DW 40S ribosomal protein S22-A 4932
421 6ZP4 14 D 40S ribosomal protein S15a 9606
422 6ZOJ 24 W 40S ribosomal protein S15a 9606
423 6ZOK 15 W 40S ribosomal protein S15a 9606
424 6ZON 15 f 40S ribosomal protein S15a 9606
425 6ZN5 22 W 40S ribosomal protein S15a 9606
426 6ZMW 31 J 40S ribosomal protein S15a 9606
427 6ZMO 77 SW 40S ribosomal protein S15a 9606
428 6ZMT 22 W 40S ribosomal protein S15a 9606
429 6ZME 77 SW 40S ribosomal protein S15a 9606
430 6ZMI 77 SW 40S ribosomal protein S15a 9606
431 6ZLW 22 W 40S ribosomal protein S15a 9606
432 6ZM7 77 SW 40S ribosomal protein S15a 9606
433 6XIQ 69 AM RPS22A isoform 1 4932
434 6XIR 66 AM RPS22A isoform 1 4932
435 6XII 27 N 30S ribosomal protein S8 562
436 6XIJ 26 N 30S ribosomal protein S8 562
437 6XGF 27 N 30S ribosomal protein S8 562
438 6XDQ 28 N 30S ribosomal protein S8 562
439 6XDR 27 N 30S ribosomal protein S8 562
440 6XE0 7 G 30S ribosomal protein S8 562
441 6X9Q 28 N 30S ribosomal protein S8 562
442 6X7K 28 N 30S ribosomal protein S8 562
443 6X6T 28 N 30S ribosomal protein S8 562
444 6X7F 28 N 30S ribosomal protein S8 562
445 6Z6J 28 SW 40S ribosomal protein S22-A 4932
446 6Z6K 28 SW 40S ribosomal protein S22-A 4932
447 6Z6L 75 SW 40S ribosomal protein S15a 9606
448 6Z6M 75 SW 40S ribosomal protein S15a 9606
449 6Z6N 75 SW 40S ribosomal protein S15a 9606
450 6WOO 70 WW uS8 4932
451 6YT9 6 i 30S ribosomal protein S8 470
452 6WNV 36 M 30S ribosomal protein S8 562
453 6WNW 38 M 30S ribosomal protein S8 562
454 6YSR 41 h 30S ribosomal protein S8 562
455 6YSS 41 h 30S ribosomal protein S8 562
456 6YST 41 h 30S ribosomal protein S8 562
457 6YSU 40 h 30S ribosomal protein S8 562
458 6YPU 6 i 30S ribosomal protein S8 470
459 6WD0 37 M 30S ribosomal protein S8 562
460 6WD1 37 M 30S ribosomal protein S8 562
461 6WD2 37 M 30S ribosomal protein S8 562
462 6WD3 37 M 30S ribosomal protein S8 562
463 6WD4 37 M 30S ribosomal protein S8 562
464 6WD5 37 M 30S ribosomal protein S8 562
465 6WD6 37 M 30S ribosomal protein S8 562
466 6WD7 37 M 30S ribosomal protein S8 562
467 6WD8 37 M 30S ribosomal protein S8 562
468 6WD9 37 M 30S ribosomal protein S8 562
469 6WDA 37 M 30S ribosomal protein S8 562
470 6WDB 37 M 30S ribosomal protein S8 562
471 6WDC 37 M 30S ribosomal protein S8 562
472 6WDD 37 M 30S ribosomal protein S8 562
473 6WDE 37 M 30S ribosomal protein S8 562
474 6WDF 37 M 30S ribosomal protein S8 562
475 6WDG 37 M 30S ribosomal protein S8 562
476 6WDH 37 M 30S ribosomal protein S8 562
477 6WDI 37 M 30S ribosomal protein S8 562
478 6WDJ 37 M 30S ribosomal protein S8 562
479 6WDK 37 M 30S ribosomal protein S8 562
480 6WDL 37 M 30S ribosomal protein S8 562
481 6WDM 37 M 30S ribosomal protein S8 562
482 6YBW 9 J 40S ribosomal protein S15a 9606
483 6YAL 23 Y 40S ribosomal protein uS8 9986
484 6YAM 23 Y 40S ribosomal protein uS8 9986
485 6YAN 22 Y Ribosomal protein S15a 9986
486 6W2S 15 X uS8 9986
487 6W2T 14 X uS8 9986
488 6VZJ 25 N 30S ribosomal protein S8 562
489 6Y7C 22 W 40S ribosomal protein S22-A 4932
490 6VYQ 26 N 30S ribosomal protein S8 562
491 6VYR 26 N 30S ribosomal protein S8 562
492 6VYS 26 N 30S ribosomal protein S8 562
493 6VYT 25 N 30S ribosomal protein S8 562
494 6VYU 26 N 30S ribosomal protein S8 562
495 6VYW 26 N 30S ribosomal protein S8 562
496 6VYX 26 N 30S ribosomal protein S8 562
497 6VYY 26 N 30S ribosomal protein S8 562
498 6VYZ 26 N 30S ribosomal protein S8 562
499 6VZ2 26 N 30S ribosomal protein S8 562
500 6VZ3 26 N 30S ribosomal protein S8 562
501 6VZ5 26 N 30S ribosomal protein S8 562
502 6VZ7 26 N 30S ribosomal protein S8 562
503 6Y69 8 h 30S ribosomal protein S8 562
504 6Y57 71 SW 40S ribosomal protein S15a 9606
505 6VWL 38 g 30S ribosomal protein S8 562
506 6VWM 38 g 30S ribosomal protein S8 562
507 6VWN 38 g 30S ribosomal protein S8 562
508 6Y2L 71 SW 40S ribosomal protein S15a 9606
509 6VU3 26 N 30S ribosomal protein S8 562
510 6Y0G 72 SW 40S ribosomal protein S15a 9606
511 6XYW 64 Bg 40S ribosomal protein S15a-5 3702
512 6LQP 17 SX 40S ribosomal protein S22-B 4932
513 6LQQ 15 SX 40S ribosomal protein S22-B 4932
514 6LQR 15 SX 40S ribosomal protein S22-B 4932
515 6LQS 15 SX 40S ribosomal protein S22-B 4932
516 6LQT 15 SX 40S ribosomal protein S22-B 4932
517 6LQU 16 SX 40S ribosomal protein S22-B 4932
518 6TNU 26 b 40S ribosomal protein S22-A 4932
519 6TMF 10 J 30S ribosomal protein S8 2264
520 6V39 38 h 30S ribosomal protein S8 470
521 6V3A 38 h 30S ribosomal protein S8 470
522 6V3B 38 h 30S ribosomal protein S8 470
523 6V3E 8 h 30S ribosomal protein S8 470
524 6TH6 10 Aj 30S ribosomal protein S8 311400
525 6UZ7 70 W 40S ribosomal protein S22 28985
526 6TC3 8 S081 30S ribosomal protein S8 562
527 6TBV 8 S081 30S ribosomal protein S8 562
528 6TB3 26 b 40S ribosomal protein S22-A 4932
529 6T83 24 Wb, x 40S ribosomal protein S22-A 4932
530 6T7T 26 SW 40S ribosomal protein S22-A 4932
531 6T7I 24 SW 40S ribosomal protein S22-A 4932
532 6T4Q 23 SW 40S ribosomal protein S22-A 4932
533 6SZS 39 h 30S ribosomal protein S8 562
534 6SW9 10 I 30S ribosomal protein S8 29292
535 6SWC 10 I 30S ribosomal protein S8 29292
536 6SWD 9 I 30S ribosomal protein S8 29292
537 6SV4 41 b, bb, bc 40S ribosomal protein S22-A 4932
538 6SPC 8 h 30S ribosomal protein S8 287
539 6SPE 8 h 30S ribosomal protein S8 287
540 6SPF 40 h 30S ribosomal protein S8 287
541 6SPG 8 h 30S ribosomal protein S8 287
542 6SNT 24 W 40S ribosomal protein S22-A 4932
543 6SKF 10 Aj 30S ribosomal protein S8 311400
544 6SKG 10 Aj 30S ribosomal protein S8 311400
545 6SGC 24 X1 Ribosomal protein S15a 9986
546 6KE6 17 SX 40S ribosomal protein S22-B 4932
547 6S47 68 BX 40S ribosomal protein S22-A TRSSVLADALNAINNAEKTGKRQVLIRPSSKVIIKFLQVMQKHGYIGEFEYIDDHRSGK IVVQLNGRLNKCGVISPRFNVKIGDIEKWTANLLPARQFGYVILTTSAGIMDHEEARRKH VSGKILGFVY 4932
548 6S0X 38 h 30S ribosomal protein S8 1280
549 6S13 38 h 30S ribosomal protein S8 1280
550 6RXT 41 Cm 40S ribosomal protein S22-like protein 209285
551 6RXU 45 Cm 40S ribosomal protein S22-like protein 209285
552 6RXV 45 Cm 40S ribosomal protein S22-like protein 209285
553 6RXX 26 Cm 40S ribosomal protein S22-like protein 209285
554 6RXY 40 Cm 40S ribosomal protein S22-like protein 2092