6RXV

Cryo-EM structure of the 90S pre-ribosome (Kre33-Noc4) from Chaetomium thermophilum, state B2


Sequence Similarity Clusters for the Entities in PDB 6RXV

Entity #1 | Chains: UA
Periodic tryptophan protein 2-like protein protein, length: 904 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13092
95 % 3 7 12500
90 % 3 7 12306
70 % 3 7 11725
50 % 3 11 7127
40 % 3 11 6871
30 % 3 11 6447
Entity #10 | Chains: UM
Utp13 protein, length: 912 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 12541
95 % 3 7 12456
90 % 3 7 12520
70 % 3 7 11685
50 % 3 7 10890
40 % 3 7 10244
30 % 3 7 9295
Entity #11 | Chains: UN
Utp14 protein, length: 938 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 12903
95 % 3 7 13216
90 % 3 7 13030
70 % 3 7 12350
50 % 3 7 11301
40 % 3 7 10632
30 % 3 7 9809
Entity #12 | Chains: UO
Utp15 protein, length: 557 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13383
95 % 3 7 13055
90 % 3 7 12863
70 % 3 7 12214
50 % 3 7 11167
40 % 3 7 10510
30 % 3 9 7877
Entity #13 | Chains: UQ
Utp17 protein, length: 960 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13156
95 % 3 7 12599
90 % 3 7 12402
70 % 3 7 11802
50 % 3 7 10792
40 % 3 7 10153
30 % 3 7 9383
Entity #14 | Chains: UR
Utp18 protein, length: 618 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 12756
95 % 3 7 12916
90 % 3 7 12726
70 % 3 7 12104
50 % 3 7 11058
40 % 3 7 10393
30 % 3 11 6614
Entity #15 | Chains: UU
Utp21 protein, length: 1049 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13155
95 % 3 7 12598
90 % 3 7 12401
70 % 3 7 11801
50 % 3 7 10791
40 % 3 7 10152
30 % 3 7 9382
Entity #16 | Chains: UX
Utp24 protein, length: 193 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 8 12132
95 % 3 8 11533
90 % 3 8 11361
70 % 3 8 10886
50 % 3 12 6452
40 % 3 12 6252
30 % 3 12 5935
Entity #17 | Chains: UZ
Utp30 protein, length: 391 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13036
95 % 3 7 13315
90 % 3 7 13264
70 % 3 7 12105
50 % 3 7 11059
40 % 3 7 10394
30 % 3 7 9591
Entity #18 | Chains: CA,CB
Nop1 protein, length: 313 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 5426
95 % 3 7 6229
90 % 3 7 6252
70 % 3 7 6165
50 % 3 11 3621
40 % 3 11 3605
30 % 3 11 3523
Entity #19 | Chains: CC
Nop56 protein, length: 523 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13154
95 % 3 7 12597
90 % 3 7 12400
70 % 3 7 11800
50 % 3 11 7120
40 % 3 15 5060
30 % 3 15 4857
Entity #2 | Chains: UB
Utp2 protein, length: 907 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13552
95 % 3 7 13443
90 % 3 7 12761
70 % 3 7 12125
50 % 3 7 11464
40 % 3 7 10780
30 % 3 7 9939
Entity #20 | Chains: CD
Nop58 protein, length: 582 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 12639
95 % 3 7 12820
90 % 3 7 12623
70 % 3 7 11887
50 % 3 7 10870
40 % 3 7 10314
30 % 3 7 9520
Entity #21 | Chains: CE,CF
Snu13 protein, length: 127 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 5425
95 % 3 7 6228
90 % 3 7 6251
70 % 3 7 6164
50 % 12 34 1339
40 % 13 35 1328
30 % 12 34 1419
Entity #22 | Chains: CG
Rrp9 protein, length: 630 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 12884
95 % 3 7 13173
90 % 3 7 12994
70 % 3 7 12312
50 % 3 7 11263
40 % 3 7 10601
30 % 3 7 9775
Entity #23 | Chains: CH
RNA 3'-terminal phosphate cyclase-like protein protein, length: 411 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13348
95 % 3 7 12986
90 % 3 7 12797
70 % 3 7 12157
50 % 3 7 11114
40 % 3 7 10447
30 % 3 7 9638
Entity #24 | Chains: CI
Bms1 protein, length: 1163 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 12956
95 % 3 7 13309
90 % 3 7 13119
70 % 3 7 12434
50 % 3 7 11387
40 % 3 11 7171
30 % 3 11 6737
Entity #25 | Chains: CJ
Imp3 protein, length: 183 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 8 12134
95 % 3 8 11813
90 % 3 8 11644
70 % 3 8 11122
50 % 3 12 6862
40 % 3 12 6637
30 % 3 12 6251
Entity #26 | Chains: CK
Imp4 protein, length: 297 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 8 12133
95 % 3 8 10220
90 % 3 8 11643
70 % 3 8 9806
50 % 3 11 7441
40 % 3 11 7167
30 % 3 11 6734
Entity #27 | Chains: CL
Mpp10 protein, length: 785 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13349
95 % 3 7 12987
90 % 3 7 12798
70 % 3 7 11900
50 % 3 7 11115
40 % 3 7 10234
30 % 3 7 9639
Entity #28 | Chains: CM
Sof1 protein, length: 446 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13350
95 % 3 7 12988
90 % 3 7 12799
70 % 3 7 12158
50 % 3 7 11116
40 % 3 9 8359
30 % 3 9 7806
Entity #29 | Chains: CN,CO
Emg1 protein, length: 252 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 4990
95 % 3 7 5911
90 % 3 7 5956
70 % 8 17 2319
50 % 8 17 2371
40 % 8 17 2388
30 % 8 17 2378
Entity #3 | Chains: UC
Utp3 protein, length: 648 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13093
95 % 3 7 12956
90 % 3 7 12307
70 % 3 7 11726
50 % 3 7 10714
40 % 3 7 10081
30 % 3 7 9323
Entity #30 | Chains: CP
KRR1 small subunit processome component protein, length: 322 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 8 9285
95 % 3 8 9519
90 % 3 8 9452
70 % 3 11 6841
50 % 3 11 6500
40 % 3 11 6297
30 % 3 11 5965
Entity #31 | Chains: CQ
Pre-rRNA-processing protein PNO1 protein, length: 259 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 12757
95 % 3 7 12917
90 % 3 7 12727
70 % 3 7 12106
50 % 3 7 11061
40 % 3 7 10395
30 % 3 7 9592
Entity #32 | Chains: CR,CS
Kre33 protein, length: 1073 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 8 4095
95 % 3 8 5017
90 % 3 8 5074
70 % 3 8 5020
50 % 3 8 4873
40 % 3 8 4765
30 % 3 8 4610
Entity #33 | Chains: CT
Fcf2 protein, length: 203 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 12958
95 % 3 7 13314
90 % 3 7 13123
70 % 3 7 12437
50 % 3 7 11389
40 % 3 7 10711
30 % 3 7 9876
Entity #34 | Chains: Ca
40S ribosomal protein S1 protein, length: 255 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 5 18280
95 % 3 5 17403
90 % 3 5 17055
70 % 46 86 468
50 % 51 142 348
40 % 53 149 346
30 % 53 149 362
Entity #35 | Chains: Cb
40S ribosomal protein S4 protein, length: 264 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 5 17910
95 % 2 5 16818
90 % 2 5 16580
70 % 50 168 264
50 % 52 178 261
40 % 52 182 263
30 % 52 187 263
Entity #36 | Chains: Cc
40S ribosomal protein s5-like protein protein, length: 212 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13545
95 % 3 7 13387
90 % 3 7 13204
70 % 8 93 626
50 % 54 188 233
40 % 54 188 241
30 % 54 188 253
Entity #37 | Chains: Cd
40S ribosomal protein S6 protein, length: 239 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 5 19391
95 % 2 5 17254
90 % 2 5 16919
70 % 7 83 712
50 % 51 169 299
40 % 51 174 300
30 % 51 174 324
Entity #38 | Chains: Ce
40S ribosomal protein S7 protein, length: 203 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13224
95 % 3 7 12747
90 % 3 7 12546
70 % 3 7 11937
50 % 51 175 282
40 % 51 175 293
30 % 53 178 296
Entity #39 | Chains: Cf
40S ribosomal protein S8 protein, length: 202 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 5 19390
95 % 2 5 17253
90 % 2 5 16918
70 % 45 88 456
50 % 52 177 265
40 % 52 181 264
30 % 52 181 285
Entity #4 | Chains: UD
Utp4 protein, length: 884 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 4 8 9204
95 % 4 8 9366
90 % 4 8 9295
70 % 4 8 9033
50 % 4 8 8393
40 % 4 8 8070
30 % 4 8 7528
Entity #40 | Chains: Cg
40S ribosomal protein s9-like protein protein, length: 190 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13223
95 % 3 7 12746
90 % 3 7 12545
70 % 52 172 257
50 % 54 187 234
40 % 54 191 239
30 % 54 191 249
Entity #41 | Chains: Ch
40S ribosomal protein S13-like protein protein, length: 151 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13255
95 % 3 7 12802
90 % 3 7 12605
70 % 52 181 243
50 % 54 184 241
40 % 54 189 240
30 % 54 189 252
Entity #42 | Chains: Ci
40S ribosomal protein S14-like protein protein, length: 150 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13301
95 % 3 7 12894
90 % 7 73 795
70 % 54 185 219
50 % 54 186 235
40 % 54 186 245
30 % 54 186 260
Entity #43 | Chains: Cj
40S ribosomal protein S16-like protein protein, length: 143 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13225
95 % 3 7 12748
90 % 3 7 12547
70 % 3 7 11938
50 % 54 179 252
40 % 54 183 253
30 % 54 184 267
Entity #44 | Chains: Ck
40S ribosomal protein S11-like protein protein, length: 161 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 5 19896
95 % 2 5 18070
90 % 2 5 17727
70 % 46 90 438
50 % 53 184 240
40 % 53 184 248
30 % 53 184 266
Entity #45 | Chains: Cm
40S ribosomal protein S22-like protein protein, length: 130 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13398
95 % 3 7 13085
90 % 3 7 12903
70 % 53 188 227
50 % 56 195 228
40 % 56 195 235
30 % 414 752 23
Entity #46 | Chains: Cn
40S ribosomal protein s23-like protein protein, length: 145 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13440
95 % 3 7 12719
90 % 3 7 12670
70 % 54 191 210
50 % 54 197 224
40 % 54 197 232
30 % 54 197 245
Entity #47 | Chains: Co
40S ribosomal protein S24 protein, length: 136 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 5 20258
95 % 2 5 18233
90 % 2 5 18170
70 % 2 5 16212
50 % 50 179 270
40 % 50 179 281
30 % 50 179 305
Entity #48 | Chains: Cp
40S ribosomal protein S28-like protein protein, length: 68 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13302
95 % 3 7 12895
90 % 3 7 12993
70 % 52 178 249
50 % 54 185 236
40 % 54 186 244
30 % 54 186 258
Entity #49 | Chains: CU
Faf1 protein, length: 311 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13399
95 % 3 7 13086
90 % 3 7 12904
70 % 3 7 12406
50 % 3 7 11357
40 % 3 7 10681
30 % 3 7 9716
Entity #5 | Chains: UF
Utp6 protein, length: 414 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 12962
95 % 3 7 13317
90 % 3 7 13213
70 % 3 7 12444
50 % 3 7 11393
40 % 3 7 10714
30 % 3 7 9882
Entity #50 | Chains: C1
35S ribosomal RNA rna, length: 2352 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
Entity #51 | Chains: C2
U3 snoRNA rna, length: 230 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
Entity #52 | Chains: UV
U3 small nucleolar RNA-associated protein 22 protein, length: 1171 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 4 29130
95 % 1 4 24091
90 % 1 4 23359
70 % 1 4 19517
50 % 1 4 17345
40 % 1 4 17358
30 % 1 4 15636
Entity #53 | Chains: CV
Rrp7 protein, length: 322 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 4 25361
95 % 1 4 25637
90 % 1 4 24819
70 % 1 4 22643
50 % 1 4 19951
40 % 1 4 18284
30 % 1 4 16405
Entity #54 | Chains: CW
Ribosome biogenesis protein ENP2 protein, length: 668 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 4 26688
95 % 2 4 20737
90 % 2 4 20240
70 % 2 4 18678
50 % 2 4 18149
40 % 2 4 16722
30 % 2 4 13984
Entity #55 | Chains: UT
Utp20 protein, length: 2612 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 4 30240
95 % 2 4 23535
90 % 2 4 22838
70 % 2 4 22516
50 % 2 4 19846
40 % 2 4 18201
30 % 2 4 15367
Entity #56 | Chains: UH
Utp8 protein, length: 930 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 6 16152
95 % 3 6 13749
90 % 3 6 13529
70 % 3 6 12679
50 % 3 6 11992
40 % 3 6 11261
30 % 3 6 10361
Entity #57 | Chains: UE,UI
Utp5 protein, length: 410 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 6 6668
95 % 3 6 7271
90 % 3 6 7260
70 % 3 6 6809
50 % 3 6 6479
40 % 3 6 6524
30 % 3 6 6175
Entity #58 | Chains: US
Noc4 protein, length: 549 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 6 16321
95 % 3 6 15418
90 % 3 6 15178
70 % 3 6 13625
50 % 3 6 12968
40 % 3 6 12090
30 % 3 6 11085
Entity #59 | Chains: Cl
Rps18 protein, length: 156 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 6 17347
95 % 3 6 15905
90 % 3 6 15653
70 % 52 170 260
50 % 54 179 258
40 % 54 185 247
30 % 54 185 265
Entity #6 | Chains: UG
Utp7 protein, length: 558 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 12961
95 % 3 7 13316
90 % 3 7 13128
70 % 3 7 12443
50 % 3 7 11392
40 % 3 9 8134
30 % 3 9 7579
Entity #60 | Chains: CX
Enp1 protein, length: 480 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 6 17817
95 % 3 6 16669
90 % 3 6 16375
70 % 3 6 15311
50 % 3 6 13841
40 % 3 6 12871
30 % 3 14 5191
Entity #61 | Chains: CY
U3 small nucleolar ribonucleoprotein protein lcp5-like protein protein, length: 381 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 3 33848
95 % 2 3 26678
90 % 2 3 25755
70 % 2 3 22994
50 % 2 3 20237
40 % 2 3 18530
30 % 2 3 16620
Entity #62 | Chains: CZ
Bfr2 protein, length: 609 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 4 28348
95 % 2 4 23046
90 % 2 4 22396
70 % 2 4 20514
50 % 2 4 18161
40 % 2 4 16735
30 % 2 4 15131
Entity #63 | Chains: UP
Utp16 protein, length: 364 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 6 15827
95 % 3 6 14263
90 % 3 6 15941
70 % 3 6 12676
50 % 3 6 11595
40 % 3 6 10905
30 % 3 6 10063
Entity #7 | Chains: UJ
UTP10 protein, length: 1802 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 8 10870
95 % 3 8 12096
90 % 3 8 11922
70 % 3 8 11347
50 % 3 8 10410
40 % 3 8 9813
30 % 3 8 9086
Entity #8 | Chains: UK
U3 small nucleolar RNA-associated protein 11 protein, length: 270 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 12963
95 % 3 7 13318
90 % 3 7 13129
70 % 3 7 12445
50 % 3 7 11394
40 % 3 7 10715
30 % 3 7 9883
Entity #9 | Chains: UL
Utp12 protein, length: 962 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13578
95 % 3 7 13432
90 % 3 7 13243
70 % 3 7 12561
50 % 3 7 11499
40 % 3 11 6977
30 % 3 11 6538

Instructions

In the table for each entity, view a list of similar sequences by selecting the link associated with the percentage cutoff.



View more detailed documentation on the redundancy reduction and sequence clustering procedure used by RCSB PDB.

You can also use the structure comparison tool to compare any 2 given structures


ACTION - (A) Select for download / view details OR (B) Select two chains for comparison
Rank PDB ID Entity ID Chains Description Details Taxonomy EC Number
1 1SEI 1 A, B RIBOSOMAL PROTEIN S8 1422
2 4YBB 8 AH, BH 30S ribosomal protein S8 562
3 4Y4O 39 1h, 2h 30S ribosomal protein S8 274
4 5J8B 41 h 30S ribosomal protein S8 274
5 1AN7 1 A, B RIBOSOMAL PROTEIN S8 274
6 4W2F 8 AH, CH 30S Ribosomal Protein S8 274
7 6CFL 39 1h, 2h 30S Ribosomal Protein S8 274
8 6CAE 39 1h, 2h 30S ribosomal protein S8 274
9 4Y4P 39 1h, 2h 30S ribosomal protein S8 274
10 1I6U 2 A, B 30S RIBOSOMAL PROTEIN S8P 2190
11 5FDV 40 1h, 2h 30S ribosomal protein S8 274
12 5J4B 39 1h, 2h 30S ribosomal protein S8 274
13 4W2G 8 AH, CH 30S Ribosomal Protein S8 274
14 6CFK 39 1h, 2h 30S ribosomal protein S8 274
15 5J7L 8 AH, BH 30S ribosomal protein S8 562
16 5W4K 39 1h, 2h 30S ribosomal protein S8 274
17 4LFB 8 H ribosomal protein S8 274
18 1VY4 8 AH, CH 30S ribosomal protein S8 274
19 4WOI 8 AH, DH 30S ribosomal protein S8 562
20 5FDU 39 1h, 2h 30S ribosomal protein S8 274
21 6I7V 12 AH, BH 30S ribosomal protein S8 562
22 4W2I 8 AH, CH 30S Ribosomal Protein S8 274
23 5JC9 8 AH, BH 30S ribosomal protein S8 562
24 1VY5 8 AH, CH 30S ribosomal protein S8 274
25 5HCQ 39 1h, 2h 30S ribosomal protein S8 274
26 4WQF 41 BH, DH 30S ribosomal protein S8 274
27 6ND5 39 1h, 2h 30S ribosomal protein S8 274
28 4W2H 8 AH, CH 30S Ribosomal Protein S8 274
29 4WPO 41 BH, DH 30S ribosomal protein S8 274
30 5J8A 8 AH, BH 30S ribosomal protein S8 562
31 4V8I 8 AH, CH 30S Ribosomal Protein S8 274
32 4JI1 8 H RIBOSOMAL PROTEIN S8 274
33 4V88 24 AW, CW 40S ribosomal protein S22-A 4932
34 4Z3S 39 1h, 2h 30S ribosomal protein S8 274
35 5DOY 39 1h, 2h 30S Ribosomal Protein S8 274
36 5J5B 8 AH, BH 30S ribosomal protein S8 562
37 5HD1 39 1h, 2h 30S ribosomal protein S8 274
38 4U4R 24 D2, d2 40S ribosomal protein S22-A 4932
39 4DR6 8 H 30S ribosomal protein S8 274
40 4LF7 8 H ribosomal protein S8 274
41 4LF8 8 H ribosomal protein S8 274
42 5WIS 39 1h, 2h 30S ribosomal protein S8 274
43 4WSD 8 72, 7E 30S ribosomal protein S8 274
44 4WQU 41 BH, DH 30S ribosomal protein S8 274
45 5WIT 39 1h, 2h 30S ribosomal protein S8 274
46 5E81 8 72, 7E 30S ribosomal protein S8 274
47 2VQE 8 H 30S RIBOSOMAL PROTEIN S8 274
48 6GSJ 8 72, 7E 30S ribosomal protein S8 274
49 4U27 8 AH, CH 30S ribosomal protein S8 562
50 6OF1 39 1h, 2h 30S ribosomal protein S8 274
51 6CFJ 39 1h, 2h 30S ribosomal protein S8 274
52 4U3U 24 D2, d2 40S ribosomal protein S22-A 4932
53 4Z8C 39 1h, 2h 30S ribosomal protein S8 274
54 5HCR 39 1h, 2h 30S ribosomal protein S8 274
55 5TBW 71 X, d2 40S ribosomal protein S22-A 4932
56 2UUB 8 H 30S RIBOSOMAL PROTEIN S8 274
57 4DV6 8 H ribosomal protein S8 274
58 4JYA 8 H 30S ribosomal protein S8 274
59 5IBB 8 72, 7E 30S ribosomal protein S8 274
60 4DR5 8 H 30S ribosomal protein S8 274
61 5J4C 39 1h, 2h 30S ribosomal protein S8 274
62 4KHP 8 H 30S Ribosomal protein S8 274
63 4DR2 8 H 30S ribosomal protein S8 274
64 4WRO 12 7E 30S ribosomal protein S8 274
65 4WQ1 8 72, 7E 30S ribosomal protein S8 274
66 4LF9 8 H ribosomal protein S8 274
67 4WQY 41 BH, DH 30S ribosomal protein S8 274
68 4DUY 8 H ribosomal protein S8 274
69 4U3M 24 D2, d2 40S ribosomal protein S22-A 4932
70 4DV7 8 H ribosomal protein S8 274
71 4WRA 8 72, 7E 30S ribosomal protein S8 274
72 1S03 2 G, H 30S ribosomal protein S8 562
73 5IB7 8 72, 7E 30S ribosomal protein S8 274
74 4U26 8 AH, CH 30S ribosomal protein S8 562
75 4X64 8 H 30S ribosomal protein S8 274
76 5HCP 39 1h, 2h 30S ribosomal protein S8 274
77 5IT8 8 AH, BH 30S ribosomal protein S8 562
78 4V9D 8 AH, BH 30S ribosomal protein S8 562
79 4V9P 40 BH, DH, FH, HH 30S ribosomal protein S8 562
80 4V9H 21 AH 30S ribosomal protein S8 274
81 4U3N 24 D2, d2 40S ribosomal protein S22-A 4932
82 5J91 8 AH, BH 30S ribosomal protein S8 562
83 4V8D 8 AK, CK 30S RIBOSOMAL PROTEIN S8 274
84 5WNT 8 H RIBOSOMAL PROTEIN S8 274
85 4DR3 8 H 30S ribosomal protein S8 274
86 4V90 8 AH 30S RIBOSOMAL PROTEIN S8 274
87 4JI3 8 H RIBOSOMAL PROTEIN S8 274
88 4WQR 8 72, 7E 30S ribosomal protein S8 274
89 4JI6 8 H RIBOSOMAL PROTEIN S8 274
90 4JI8 8 H RIBOSOMAL PROTEIN S8 274
91 2UXC 8 H RIBOSOMAL PROTEIN S8 274
92 5IB8 8 72, 7E 30S ribosomal protein S8 274
93 4V9R 8 AH, CH 30S Ribosomal Protein S8 274
94 4B3M 8 H 30S RIBOSOMAL PROTEIN S8 274
95 5EL6 8 72, 7E 30S ribosomal protein S8 274
96 6O97 39 1h, 2h 30S ribosomal protein S8 274
97 5EL7 8 72, 7E 30S ribosomal protein S8 274
98 5VP2 39 1h, 2h 30S ribosomal protein S8 274
99 4U52 24 D2, d2 40S ribosomal protein S22-A 4932
100 4LF4 8 H ribosomal protein S8 274
101 5DFE 42 QH, XH 30S ribosomal protein S8 274
102 5NDK 50 72, 7E 30S ribosomal protein S8 274
103 4LF6 8 H ribosomal protein S8 274
104 4JI7 8 H RIBOSOMAL PROTEIN S8 274
105 5J88 8 AH, BH 30S ribosomal protein S8 562
106 4U24 8 AH, CH 30S ribosomal protein S8 562
107 4WU1 8 72, 7E 30S ribosomal protein S8 274
108 4U4Q 24 D2, d2 40S ribosomal protein S22-A 4932
109 6QNR 8 72, 7E 30S ribosomal protein S8 274
110 5EL4 8 72, 7E 30S ribosomal protein S8 274
111 5WNV 8 H 30S ribosomal protein S8 274
112 4U6F 24 D2, d2 40S ribosomal protein S22-A 4932
113 4B3T 8 H 30S RIBOSOMAL PROTEIN S8 274
114 4WR6 8 72, 7E 30S ribosomal protein S8 274
115 4V8B 8 AK, CK 30S RIBOSOMAL PROTEIN S8 274
116 5HAU 41 1h, 2h 30S ribosomal protein S8 274
117 4V9O 41 BH, DH, FH, HH 30S ribosomal protein S8 562
118 6MPF 8 H 30S ribosomal protein S8 274
119 2VQF 8 H 30S RIBOSOMAL PROTEIN S8 274
120 2UUA 8 H 30S RIBOSOMAL PROTEIN S8 274
121 4V87 38 BK, CK 30S RIBOSOMAL PROTEIN S8 274
122 4WF1 8 AH, CH 30S ribosomal protein S8 562
123 4U25 8 AH, CH 30S ribosomal protein S8 562
124 4V95 8 AH, CH 30S Ribosomal Protein S8 274
125 4WWW 39 QH, XH 30S ribosomal protein S8 562
126 4V7T 8 AH, CH 30S ribosomal protein S8 562
127 1VY7 8 AH, CH 30S ribosomal protein S8 274
128 4U4U 24 D2, d2 40S ribosomal protein S22-A 4932
129 5E7K 8 72, 7E 30S ribosomal protein S8 274
130 4U4Z 24 D2, d2 40S ribosomal protein S22-A 4932
131 5EL5 8 72, 7E 30S ribosomal protein S8 274
132 6FKR 39 1h, 2h 30S ribosomal protein S8 274
133 4B3R 8 H 30S RIBOSOMAL PROTEIN S8 274
134 4LNT 8 QH, XH 30S ribosomal protein S8 274
135 4U4Y 24 D2, d2 40S ribosomal protein S22-A 4932
136 4DR1 8 H 30S ribosomal protein S8 274
137 4LFA 8 H ribosomal protein S8 274
138 4U4N 24 D2, d2 40S ribosomal protein S22-A 4932
139 4DV4 8 H ribosomal protein S8 274
140 4U55 24 D2, d2 40S ribosomal protein S22-A 4932
141 4YZV 8 QH, XH 30S ribosomal protein S8 274
142 4JI0 8 H ribosomal protein S8 274
143 5IWA 7 H 30S ribosomal protein S8 274
144 4V7U 8 AH, CH 30S ribosomal protein S8 562
145 4V9S 8 AH, CH 30S Ribosomal Protein S8 274
146 4JI2 8 H RIBOSOMAL PROTEIN S8 274
147 4V6C 7 AH, CH 30S ribosomal protein S8 562
148 4JV5 8 H 30S ribosomal protein S8 274
149 4DR7 8 H 30S ribosomal protein S8 274
150 1J5E 8 H 30S RIBOSOMAL PROTEIN S8 274
151 4GKK 8 H 30S ribosomal protein S8 274
152 4DUZ 8 H ribosomal protein S8 274
153 5NDJ 50 72, 7E 30S ribosomal protein S8 274
154 4V7V 8 AH, CH 30S ribosomal protein S8 562
155 4X65 8 H 30S ribosomal protein S8 274
156 4V8G 8 AH, CH 30S Ribosomal Protein S8 274
157 4GKJ 8 H 30S ribosomal protein S8 274
158 4DV3 8 H ribosomal protein S8 274
159 4V7S 8 AH, CH 30S ribosomal protein S8 562
160 4DV5 8 H ribosomal protein S8 274
161 5DAT 24 D2 40S ribosomal protein S22-A 4932
162 5DAT 80 d2 40S ribosomal protein S22-A 4932
163 2UUC 8 H 30S RIBOSOMAL PROTEIN S8 274
164 4LFC 8 H ribosomal protein S8 274
165 1FJG 9 H 30S RIBOSOMAL PROTEIN S8 274
166 3T1Y 8 H 30S ribosomal protein S8 274
167 4WZO 8 72, 7E 30S ribosomal protein S8 274
168 4JI4 8 H RIBOSOMAL PROTEIN S8 274
169 1VY6 8 AH, CH 30S ribosomal protein S8 274
170 1XMQ 10 H 30S Ribosomal Protein S8 274
171 5WNP 8 H 30S ribosomal protein S8 274
172 6CAP 8 H 30S ribosomal protein S8 274
173 4U20 8 AH, CH 30S ribosomal protein S8 562
174 6MPI 8 H 30S ribosomal protein S8 274
175 5I4L 24 D2, d2 40S ribosomal protein S22-A 4932
176 4DV0 8 H ribosomal protein S8 274
177 4V9B 8 AK, CK 30S RIBOSOMAL PROTEIN S8 274
178 4U1V 8 AH, CH 30S ribosomal protein S8 562
179 4V6F 38 BK, CK 30S ribosomal protein S8 274
180 4X62 8 H 30S ribosomal protein S8 274
181 4V8F 38 BK, CK 30S RIBOSOMAL PROTEIN S8 274
182 4U51 24 D2, d2 40S ribosomal protein S22-A 4932
183 4B3S 8 H 30S RIBOSOMAL PROTEIN S8 274
184 4DV2 8 H ribosomal protein S8 274
185 4DV1 8 H ribosomal protein S8 274
186 5WNU 8 H 30S ribosomal protein S8 274
187 1N32 10 H 30S RIBOSOMAL PROTEIN S8 274
188 5F8K 39 1h, 2h 30S ribosomal protein S8 274
189 1I94 8 H 30S RIBOSOMAL PROTEIN S8 274
190 6HHQ 70 X, d2 40S ribosomal protein S22-A 4932
191 4V8H 8 AH, CH 30S Ribosomal Protein S8 274
192 5OBM 68 D2, d2 40S ribosomal protein S22-A 4932
193 4JI5 8 H RIBOSOMAL PROTEIN S8 274
194 6CAQ 8 H 30S ribosomal protein S8 274
195 4K0K 8 H 30S ribosomal protein S8 274
196 4W2E 41 h 30S ribosomal protein S8 274
197 4V8C 38 CK, DK 30S RIBOSOMAL PROTEIN S8 274
198 5BR8 8 H 30S ribosomal protein S8 274
199 4LF5 8 H ribosomal protein S8 274
200 5J4D 42 QA, VC 30S ribosomal protein S8 274
201 4V9A 8 AK, CK 30S RIBOSOMAL PROTEIN S8 274
202 4U53 24 D2, d2 40S ribosomal protein S22-A 4932
203 5ON6 72 X, d2 40S ribosomal protein S22-A 4932
204 4V5J 8 AH, CH 30S RIBOSOMAL PROTEIN S8 274
205 4U50 24 D2, d2 40S ribosomal protein S22-A 4932
206 5NDV 68 D2, d2 40S ribosomal protein S22-A 4932
207 5LYB 24 D2, d2 40S ribosomal protein S22-A 4932
208 6ND6 39 1h, 2h 30S ribosomal protein S8 274
209 4V7Y 8 AH, CH 30S ribosomal protein S8 274
210 6UO1 39 1h, 2h 30S ribosomal protein S8 274
211 6GSK 8 72, 7E 30S ribosomal protein S8 274
212 4V9C 8 AH, CH 30S ribosomal protein S8 562
213 4V8E 38 BK, DK 30S RIBOSOMAL PROTEIN S8 274
214 5J30 39 QH, XH 30S ribosomal protein S8 274
215 6QNQ 8 72, 7E 30S ribosomal protein S8 274
216 4DR4 8 H 30S ribosomal protein S8 274
217 4WZD 8 72, 7E 30S ribosomal protein S8 274
218 3OTO 8 H 30S RIBOSOMAL PROTEIN S8 274
219 4X66 8 H 30S ribosomal protein S8 274
220 2UU9 8 H 30S RIBOSOMAL PROTEIN S8 274
221 4V8Q 42 BH 30S RIBOSOMAL PROTEIN S8 274
222 4U56 24 D2, d2 40S ribosomal protein S22-A 4932
223 4V85 8 AH 30S ribosomal protein S8 562
224 1HR0 9 H 30S RIBOSOMAL PROTEIN S8 274
225 4AQY 8 H 30S RIBOSOMAL PROTEIN S8 274
226 4W4G 8 QH, XH 30S ribosomal protein S8 274
227 4NXM 8 H ribosomal protein S8 274
228 4V5L 8 AH 30S RIBOSOMAL PROTEIN S8 274
229 4YPB 8 QH, XH 30S ribosomal protein S8 274
230 4V7X 8 AH, CH 30S ribosomal protein S8 274
231 5TGA 24 D2, d2 40S ribosomal protein S22-A 4932
232 4U1U 8 AH, CH 30S ribosomal protein S8 562
233 4ZER 39 1h, 2h 30S ribosomal protein S8 274
234 1IBL 11 H 30S RIBOSOMAL PROTEIN S8 274
235 5MEI 71 X, d2 40S ribosomal protein S22-A 4932
236 4V7W 8 AH, CH 30S ribosomal protein S8 274
237 4WT1 8 72, 7E 30S ribosomal protein S8 274
238 6C5L 8 AH, CH 30S ribosomal protein S8 274
239 4WT8 8 AH, BH 30S ribosomal protein S8 274
240 5DOX 39 1h, 2h 30S ribosomal protein S8 274
241 6OTR 8 QH, XH 30S ribosomal protein S8 274
242 4NXN 8 H ribosomal protein S8 274
243 1XNR 10 H 16S Ribosomal protein S8 274
244 4LT8 8 QH, XH 30S ribosomal protein S8 274
245 5FCJ 24 D2, d2 40S ribosomal protein S22-A 4932
246 5WNQ 8 H 30S ribosomal protein S8 274
247 4U4O 24 D2, d2 40S ribosomal protein S22-A 4932
248 6MKN 8 H 30S ribosomal protein S8 274
249 4V51 8 AH, CH 30S RIBOSOMAL PROTEIN S8 274
250 6DTI 8 H 30S ribosomal protein S8 274
251 4V7L 8 AH, CH 30S ribosomal protein S8 274
252 4V5R 8 AH, CH 30S RIBOSOMAL PROTEIN S8 274
253 1HNZ 9 H 30S RIBOSOMAL PROTEIN S8 274
254 1XNQ 10 H Ribosomal protein S8 274
255 4V8A 38 CH, DH 30S ribosomal protein S8 274
256 4V5K 8 AH, CH 30S RIBOSOMAL PROTEIN S8 274
257 4V5Q 8 AH, CH 30S RIBOSOMAL PROTEIN S8 274
258 4V7J 7 Ah, Bh 30S ribosomal protein S8 274
259 5DGV 24 D2, d2 40S ribosomal protein S22-A 4932
260 6BZ6 8 QH, XH 30S ribosomal protein S8 274
261 5DGE 24 D2, d2 40S ribosomal protein S22-A 4932
262 5J3C 39 QH, XH 30S ribosomal protein S8 274
263 4V5C 8 AH, CH 30S RIBOSOMAL PROTEIN S8 274
264 4V5E 8 AH, CH 30S RIBOSOMAL PROTEIN S8 274
265 4L47 8 QH, XH 30S ribosomal protein S8 274
266 4V5P 8 AH, CH 30S RIBOSOMAL PROTEIN S8 274
267 5V8I 39 1h, 2h 30S ribosomal protein S8 274
268 4ZSN 8 QH, XH 30S ribosomal protein S8 274
269 4V5D 8 AH, CH 30S RIBOSOMAL PROTEIN S8 274
270 5NDW 17 D2, d2 40S ribosomal protein S22-A 4932
271 6CZR 39 1h, 2h 30S ribosomal protein S8 274
272 6OXA 8 QH, XH 30S ribosomal protein S8 274
273 6BUW 8 QH, XH 30S ribosomal protein S8 274
274 4V7Z 8 AH, CH 30S ribosomal protein S8 274
275 4V8X 8 AH, CH 30S RIBOSOMAL PROTEIN S8 274
276 4V5S 8 AH, CH 30S RIBOSOMAL PROTEIN S8 274
277 4V9I 8 AH, CH 30S Ribosomal protein S8 274
278 1XMO 10 H 30S ribosomal protein S8 274
279 3T1H 8 H 30S ribosomal protein S8 274
280 2UXD 8 H RIBOSOMAL PROTEIN S8 274
281 1N33 10 H 30S RIBOSOMAL PROTEIN S8 274
282 1IBK 9 H 30S RIBOSOMAL PROTEIN S8 274
283 4V6G 8 AK, CK 30S RIBOSOMAL PROTEIN S8 274
284 4V8N 8 AH, CH 30S RIBOSOMAL PROTEIN S8 274
285 4V97 8 AH, CH 30S ribosomal protein S8 274
286 6CAR 8 H 30S ribosomal protein S8 274
287 1HNW 9 H 30S RIBOSOMAL PROTEIN S8 274
288 4V7M 8 AH, CH 30S ribosomal protein S8 274
289 4WSM 8 72, 7E 30S ribosomal protein S8 274
290 4TUD 8 QH, XH 30S ribosomal protein S8 274
291 1IBM 11 H 30S RIBOSOMAL PROTEIN S8 274
292 5WNR 8 H 30S ribosomal protein S8 274
293 6CAO 8 H 30S ribosomal protein S8 274
294 4V6A 8 AH, CH 30S ribosomal protein S8 274
295 4TUE 8 QH, XH 30S ribosomal protein S8 274
296 6OXI 8 QH, XH 30S ribosomal protein S8 274
297 4TUA 8 QH, XH 30S ribosomal protein S8 274
298 4BTS 18 AH, BH, CH, DH 40S RIBOSOMAL PROTEIN RPS22E 5911
299 4V84 8 AH, CH 30S ribosomal protein S8 274
300 5WNS 8 H 30S ribosomal protein S8 274
301 6NDK 8 QH, XH 30S ribosomal protein S8 274
302 4V7K 7 Ah, Bh 30S ribosomal protein S8 274
303 4YY3 8 H 30S ribosomal protein S8 274
304 1HNX 9 H 30S RIBOSOMAL PROTEIN S8 274
305 4V9Q 38 BH, DH 30S ribosomal protein S8 274
306 6BZ8 8 QH, XH 30S ribosomal protein S8 274
307 4TUC 8 QH, XH 30S ribosomal protein S8 274
308 4YHH 8 H 30S ribosomal protein S8 274
309 5VPO 9 QH, XH 30S ribosomal protein S8 274
310 6NY6 8 H 30S ribosomal protein S8 274
311 5NDG 24 D2, d2 40S ribosomal protein S22-A 4932
312 4TUB 8 QH, XH 30S ribosomal protein S8 274
313 4V9N 11 AH, CH 30S ribosomal protein S8 274
314 5FCI 24 D2, d2 40S ribosomal protein S22-A 4932
315 4P70 8 QH, XH 30S ribosomal protein S8 274
316 4V8U 8 AH, CH 30S RIBOSOMAL PROTEIN S8 274
317 4LSK 8 QH, XH 30S ribosomal protein S8 274
318 5DC3 24 D2, d2 40S ribosomal protein S22-A 4932
319 4V6D 7 AH, CH 30S ribosomal protein S8 562
320 4P6F 8 QH, XH 30S ribosomal protein S8 274
321 4V67 10 AH, CH 30S ribosomal protein S8 274
322 4V83 8 AH, CH 30S ribosomal protein S8 274
323 5DGF 24 D2, d2 40S ribosomal protein S22-A 4932
324 4V5F 8 AH, CH 30S RIBOSOMAL PROTEIN S8 274
325 4V5O 17 AH, BH RIBOSOMAL PROTEIN S8 CONTAINING PROTEIN 5911
326 1VVJ 8 QH, XH 30S ribosomal protein S8 274
327 4LFZ 8 QH, XH 30S ribosomal protein S8 274
328 2E5L 9 H 30S ribosomal protein S8 274
329 6BZ7 8 QH, XH 30S ribosomal protein S8 274
330 6N1D 42 AS08, BS08 30S ribosomal protein S8 274
331 4V6E 7 AH, CH 30S ribosomal protein S8 562
332 6UCQ 38 1h, 2h 30S ribosomal protein S8 274
333 6CAS 8 H 30S ribosomal protein S8 274
334 4V52 7 AH, CH 30S ribosomal protein S8 562
335 5CZP 39 QH, XH 30S ribosomal protein S8 274
336 6N9F 39 1h, 2h 30S Ribosomal Protein S8 274
337 6N9E 39 1h, 2h 30S Ribosomal Protein S8 274
338 2HHH 8 H 30S ribosomal protein S8 274
339 4V89 8 AH 30S ribosomal protein S8 562
340 4OX9 8 H 30S ribosomal protein S8 274
341 4V54 7 AH, CH 30S ribosomal protein S8 562
342 2UXB 8 H RIBOSOMAL PROTEIN S8 274
343 1I96 8 H 30S RIBOSOMAL PROTEIN S8 274
344 5TGM 24 D2, d2 40S ribosomal protein S22-A 4932
345 4V9K 7 AH, CH 30S ribosomal protein S8 274
346 4V50 10 AH, CH 30S ribosomal protein S8 562
347 1N34 9 H 30S RIBOSOMAL PROTEIN S8 274
348 4V57 7 AH, CH 30S ribosomal protein S8 562
349 4V5A 8 AH, CH 30S RIBOSOMAL PROTEIN S8 274
350 4V63 10 AH, CH 30S ribosomal protein S8 274
351 4L71 8 QH, XH 30S ribosomal protein S8 274
352 4KVB 8 H 30S ribosomal protein S8 274
353 4XEJ 35 AS08, BS08 30S ribosomal protein S8 274
354 4V64 7 AH, CH 30S ribosomal protein S8 562
355 4V7P 8 AH, DH 30S ribosomal protein S8 274
356 4V8J 8 AH, CH 30S ribosomal protein S8 274
357 1N36 8 H 30S RIBOSOMAL PROTEIN S8 274
358 2ZM6 8 H 30S ribosomal protein S8 274
359 4V4H 7 AH, CH 30S RIBOSOMAL PROTEIN S8 562
360 4V4Q 7 AH, CH 30S ribosomal protein S8 562
361 4V5B 40 BH, DH 30S RIBOSOMAL PROTEIN S8 RESIDUES 2-130 562
362 5D8B 35 EC, IA 30S ribosomal protein S8 274
363 6BY1 43 AH, BH 30S ribosomal protein S8 562
364 4LEL 8 QH, XH 30S ribosomal protein S8 274
365 4V53 7 AH, CH 30S ribosomal protein S8 562
366 2F4V 9 H 30S ribosomal protein S8 274
367 4V9L 7 AH, CH 30S ribosomal protein S8 274
368 1FKA 8 H 30S RIBOSOMAL PROTEIN S8 274
369 4V5G 8 AH, CH 30S RIBOSOMAL PROTEIN S8 274
370 4V56 7 AH, CH 30S ribosomal protein S8 562
371 1I97 8 H 30S RIBOSOMAL PROTEIN S8 274
372 4V9J 7 AH, CH 30S ribosomal protein S8 274
373 4V55 7 AH, CH 30S ribosomal protein S8 562
374 1I95 8 H 30S RIBOSOMAL PROTEIN S8 274
375 4V8O 8 AH 30S RIBOSOMAL PROTEIN S8 274
376 4V7R 16 AO, CO 40S ribosomal protein S22-A 4932
377 4V9M 7 AH, CH 30S ribosomal protein S8 274
378 4W29 7 AH, CH 30S ribosomal protein S8 274
379 4V5Y 7 AH, CH 30S ribosomal protein S8 562
380 4V4Y 10 AK 30S ribosomal protein S8 274
381 4V4J 41 i 30S ribosomal protein S8 274
382 4V4X 10 AK 30S ribosomal protein S8 274
383 4V4Z 11 AK 30S ribosomal protein S8 274
384 4V4I 41 i 30S ribosomal protein S8 274
385 4V4P 43 BK 30S ribosomal protein S8 274
386 5VYC 16 W1, W2, W3, W4, W5, W6 40S ribosomal protein S15a 9606
387 4V4R 11 AH 30S ribosomal protein S8 274
388 4V4S 11 AH 30S ribosomal protein S8 274
389 4V4T 11 AH 30S ribosomal protein S8 274
390 4KZZ 23 W 40S Ribosomal Protein S15A 9986
391 4KZX 23 W 40S ribosomal protein S15A 9986
392 4KZY 23 W 40S Ribosomal Protein S15A 9986
393 4V49 10 AH 30S ribosomal protein S8 562
394 4V4A 8 AH 30S ribosomal protein S8 562
395 4V4G 8 AH, CH, EH, GH, IH 30S ribosomal protein S8 562
396 6UZ7 70 W 40S ribosomal protein S22 28985
397 6TC3 8 S081 30S ribosomal protein S8 562
398 6TBV 8 S081 30S ribosomal protein S8 562
399 6T83 24 Wb, x 40S ribosomal protein S22-A 4932
400 6T7T 24 SW 40S ribosomal protein S22-A 4932
401 6T7I 24 SW 40S ribosomal protein S22-A 4932
402 6T4Q 23 SW 40S ribosomal protein S22-A 4932
403 6SZS 39 h 30S ribosomal protein S8 562
404 6SPC 8 h 30S ribosomal protein S8 287
405 6SPE 8 h 30S ribosomal protein S8 287
406 6SPF 40 h 30S ribosomal protein S8 287
407 6SPG 8 h 30S ribosomal protein S8 287
408 6SGC 24 X1 Ribosomal protein S15a 9986
409 6S47 68 BX 40S ribosomal protein S22-A TRSSVLADALNAINNAEKTGKRQVLIRPSSKVIIKFLQVMQKHGYIGEFEYIDDHRSGK IVVQLNGRLNKCGVISPRFNVKIGDIEKWTANLLPARQFGYVILTTSAGIMDHEEARRKH VSGKILGFVY 4932
410 6S0X 38 h 30S ribosomal protein S8 1280
411 6S13 38 h 30S ribosomal protein S8 1280
412 6RXT 41 Cm 40S ribosomal protein S22-like protein 209285
413 6RXU 45 Cm 40S ribosomal protein S22-like protein 209285
414 6RXV 45 Cm 40S ribosomal protein S22-like protein 209285
415 6RXX 26 Cm 40S ribosomal protein S22-like protein 209285
416 6RXY 40 Cm 40S ribosomal protein S22-like protein 209285
417 6RXZ 44 Cm 40S ribosomal protein S22-like protein 209285
418 6P5I 24 X uS8 9986
419 6P5J 24 X uS8 9986
420 6P5K 70 X uS8 9986
421 6P5N 70 X uS8 9986
422 6P4G 24 X uS8 9986
423 6P4H 25 X uS8 9986
424 6OUO 40 m 30S ribosomal protein S8 562
425 6RM3 69 SW0 uS8 6039
426 6OSQ 41 m 30S ribosomal protein S8 562
427 6OST 38 m 30S ribosomal protein S8 562
428 6OT3 40 m 30S ribosomal protein S8 562
429 6OSK 40 m 30S ribosomal protein S8 562
430 6ORE 42 m 30S ribosomal protein S8 562
431 6ORL 38 m 30S ribosomal protein S8 562
432 6OM7 29 SW 40S ribosomal protein S15a 9606
433 6OLZ 69 BW 40S ribosomal protein S15a 9606
434 6OM0 29 SW 40S ribosomal protein S15a 9606
435 6OLE 29 SW 40S ribosomal protein S15a 9606
436 6OLF 29 SW 40S ribosomal protein S15a 9606
437 6OLG 72 BW 40S ribosomal protein S15a 9606
438 6OLI 29 SW 40S ribosomal protein S15a 9606
439 6OKK 11 K 40S ribosomal protein S15A 5833
440 6RBD 15 W 40S ribosomal protein S22-A 4932
441 6RBE 15 W 40S ribosomal protein S22-A 4932
442 6OGF 35 M 30S ribosomal protein S8 562
443 6OGG 35 M 30S ribosomal protein S8 562
444 6OGI 35 M 30S ribosomal protein S8 562
445 6OFX 35 M 30S ribosomal protein S8 562
446 6OG7 35 M 30S ribosomal protein S8 562
447 6R7Q 82 TT Ribosomal protein S15a 9986
448 6R6G 50 TT Ribosomal protein S15a 9986
449 6R6P 66 TT Ribosomal protein S15a 9986
450 6R5Q 74 TT Ribosomal protein S15a 9986
451 6O9J 38 h 30S ribosomal protein S8 562
452 6O9K 8 h 30S ribosomal protein S8 562
453 6QZP 76 SW 40S ribosomal protein S15a 9606
454 6O7K 22 p 30S ribosomal protein S8 562
455 6NQB 9 H 30S ribosomal protein S8 562
456 6Q95 8 m 30S ribosomal protein S8 274
457 6Q97 45 m 30S ribosomal protein S8 562
458 6Q98 43 m 30S ribosomal protein S8 562
459 6Q9A 43 m 30S ribosomal protein S8 562
460 6Q8Y 27 b 40S ribosomal protein S22-A 4932
461 6I7O 41 b, bb 40S ribosomal protein S22-A 4932
462 6IP5 75 3M 40S ribosomal protein S15a 9606
463 6IP6 74 3M 40S ribosomal protein S15a 9606
464 6IP8 74 3M 40S ribosomal protein S15a 9606
465 6MTB 73 WW 40S ribosomal protein S15a 9986
466 6MTC 72 WW 40S ribosomal protein S15a 9986
467 6MTD 74 WW uS8 9986
468 6MTE 73 WW uS8 9986
469 6HTQ 37 h 30S ribosomal protein S8 1423
470 6HRM 40 m 30S ribosomal protein S8 562
471 6HCQ 27 X2 Ribosomal protein S15a 9986
472 6HCJ 27 X2 Ribosomal protein S15a 9986
473 6HCM 24 X1 Ribosomal protein S15a 9986
474 6HCF 24 X1 Ribosomal protein S15a 9986
475 6HA1 38 h 30S ribosomal protein S8 1423
476 6HA8 40 h 30S ribosomal protein S8 1423
477 6H58 39 h, hh 30S ribosomal protein S8 562
478 6H4N 8 h 30S ribosomal protein S8 562
479 6DZI 8 q 30S ribosomal protein S8 1772
480 6DZK 8 H 30S ribosomal protein S8 1772
481 6GZX 38 H3, H4 30S ribosomal protein S8 274
482 6GZZ 38 H3, H4 30S ribosomal protein S8 274
483 6GZQ 38 H2 30S ribosomal protein S8 274
484 6GZ3 33 BW Ribosomal protein S15a 9986
485 6GZ4 36 BW ribosomal protein uS8 9986
486 6GZ5 33 BW ribosomal protein uS8 9986
487 6GXM 41 h 30S ribosomal protein S8 562
488 6GXN 41 h 30S ribosomal protein S8 562
489 6GXO 41 h 30S ribosomal protein S8 562
490 6GXP 40 h 30S ribosomal protein S8 562
491 6GWT 41 h 30S ribosomal protein S8 562
492 6GSL 8 72, 7E 30S ribosomal protein S8 274
493 6GSM 26 W 40S ribosomal protein S22 28985
494 6GSN 40 W 40S ribosomal protein S22 28985
495 6GQV 70 AM 40S ribosomal protein S22-A 4932
496 6GQ1 70 AM 40S ribosomal protein S22-A 4932
497 6GQB 70 AM 40S ribosomal protein S22-A 4932
498 6DNC 45 UA 30S ribosomal protein S8 562
499 6D9J 72 XX uS8 9986
500 6D90 73 XX uS8 9986
501 5ZLU 15 N 30S ribosomal protein S8 274
502 6G5H 14 W 40S ribosomal protein S15a 9606
503 6G5I 24 W 40S ribosomal protein S15a 9606
504 6G4S 19 W 40S ribosomal protein S15a 9606
505 6G4W 16 W 40S ribosomal protein S15a 9606
506 6G51 15 W 40S ribosomal protein S15a 9606
507 6G53 15 W 40S ribosomal protein S15a 9606
508 6G18 25 W 40S ribosomal protein S15a 9606
509 6FYX 26 W 40S ribosomal protein S22 28985
510 6FYY 26 W 40S ribosomal protein S22 28985
511 6FXC 8 Ah, Bh 30S ribosomal protein S8 1280
512 5ZEU 5 h 30S ribosomal protein S8 1772
513 5ZEB 5 h 30S ribosomal protein S8 1772
514 5ZEP 5 h 30S ribosomal protein S8 1772
515 6C4I 41 h 30S ribosomal protein S8 562
516 6FEC 29 a 40S ribosomal protein S15a 9606
517 6FAI 33 W 40S ribosomal protein S22-A 4932
518 6BU8 38 H 30S ribosomal protein S8 562
519 6BOH 42 RA, WC 30S ribosomal protein S8 274
520 6BOK 41 PA, SC 30S ribosomal protein S8 274
521 6ERI 41 BH 30S ribosomal protein S8, chloroplastic 3562
522 6ENU 8 h 30S ribosomal protein S8 562
523 6ENJ 38 h 30S ribosomal protein S8 562
524 6ENF 8 h 30S ribosomal protein S8 562
525 6EML 24 b 40S ribosomal protein S22-A 4932
526 6B4V 42 QA, UC 30S ribosomal protein S8 274
527 6EK0 76 SW 40S ribosomal protein S15a 9606
528 6AZ1 10 J ribosomal protein S8 5661
529 6AWB 13 K 30S ribosomal protein S8 562
530 6AWC 13 K 30S ribosomal protein S8 562
531 6AWD 12 K 30S ribosomal protein S8 562
532 5OT7 14 G 30S ribosomal protein S8 274
533 5OQL 45 w 40S ribosomal protein S22-like protein 209285
534 5OPT 22 e 40S ribosomal protein S15a, putative 5693
535 5WLC 13 LE rpS22_uS8 4932
536 5WFK 41 h 30S ribosomal protein S8 562
537 5WFS 41 h 30S ribosomal protein S8 562
538 5WF0 41 h 30S ribosomal protein S8 562
539 5XYU 7 H 30S ribosomal protein S8 1772
540 5XYI 24 W Ribosomal protein S15a 5722
541 5WE4 41 h 30S ribosomal protein S8 562
542 5WE6 41 h 30S ribosomal protein S8 562
543 5WDT 41 h 30S ribosomal protein S8 562
544 5XXU 24 W Ribosomal protein uS8 5811
545 5OA3 27 W 40S ribosomal protein S15a 9606
546 5O61 42 BH 30S ribosomal protein S8 1772
547 5O5J 8 H 30S ribosomal protein S8 1772
548 5O2R 42 h 30S ribosomal protein S8 562
549 5NWY 42 7 30S ribosomal protein S8