6RXV

Cryo-EM structure of the 90S pre-ribosome (Kre33-Noc4) from Chaetomium thermophilum, state B2


Sequence Similarity Clusters for the Entities in PDB 6RXV

Entity #1 | Chains: UA
Periodic tryptophan protein 2-like protein protein, length: 904 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 14484
95 % 3 7 13737
90 % 3 7 13550
70 % 3 7 12771
50 % 17 25 3367
40 % 17 25 3350
30 % 17 25 3308
Entity #10 | Chains: UM
Utp13 protein, length: 912 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13938
95 % 3 7 13860
90 % 3 7 13678
70 % 3 7 12886
50 % 3 7 11725
40 % 3 7 11020
30 % 3 7 10147
Entity #11 | Chains: UN
Utp14 protein, length: 938 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13851
95 % 3 7 13715
90 % 3 7 13973
70 % 3 7 12978
50 % 3 7 11957
40 % 3 7 11100
30 % 3 7 10344
Entity #12 | Chains: UO
Utp15 protein, length: 557 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 14543
95 % 3 7 13686
90 % 3 7 13651
70 % 3 7 12863
50 % 3 7 11702
40 % 3 7 10996
30 % 16 22 3812
Entity #13 | Chains: UQ
Utp17 protein, length: 960 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 14804
95 % 3 7 14355
90 % 3 7 14155
70 % 3 7 13310
50 % 3 7 12115
40 % 3 7 11383
30 % 3 7 10471
Entity #14 | Chains: UR
Utp18 protein, length: 618 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 14456
95 % 3 7 13672
90 % 3 7 13489
70 % 3 7 12721
50 % 3 7 11582
40 % 3 7 10870
30 % 16 24 3504
Entity #15 | Chains: UU
Utp21 protein, length: 1049 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 14805
95 % 3 7 14356
90 % 3 7 14156
70 % 3 7 13311
50 % 3 7 12116
40 % 3 7 11384
30 % 3 7 10472
Entity #16 | Chains: UX
Utp24 protein, length: 193 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 8 13378
95 % 3 8 12598
90 % 3 8 12474
70 % 3 8 11848
50 % 17 26 3212
40 % 17 26 3255
30 % 17 26 3221
Entity #17 | Chains: UZ
Utp30 protein, length: 391 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 14284
95 % 3 7 14548
90 % 3 7 14347
70 % 3 7 13468
50 % 3 7 12265
40 % 3 7 11524
30 % 3 7 10602
Entity #18 | Chains: CA,CB
Nop1 protein, length: 313 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 5667
95 % 3 7 6669
90 % 3 7 6682
70 % 3 7 6576
50 % 16 24 1680
40 % 16 24 1718
30 % 16 24 1745
Entity #19 | Chains: CC
Nop56 protein, length: 523 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13850
95 % 3 7 13968
90 % 3 7 13777
70 % 3 7 13140
50 % 16 24 3699
40 % 29 41 2051
30 % 29 41 2078
Entity #2 | Chains: UB
Utp2 protein, length: 907 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 15047
95 % 3 7 14806
90 % 3 7 14593
70 % 3 7 13695
50 % 3 7 12480
40 % 3 7 11715
30 % 3 7 10768
Entity #20 | Chains: CD
Nop58 protein, length: 582 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13980
95 % 3 7 13922
90 % 3 7 14645
70 % 3 7 12938
50 % 3 7 11882
40 % 3 7 11177
30 % 3 7 10285
Entity #21 | Chains: CE,CF
Snu13 protein, length: 127 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 5742
95 % 3 7 6804
90 % 3 7 6810
70 % 3 7 6696
50 % 25 47 971
40 % 26 48 970
30 % 25 47 1042
Entity #22 | Chains: CG
Rrp9 protein, length: 630 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 14350
95 % 3 7 14678
90 % 3 7 14474
70 % 3 7 13577
50 % 3 7 12373
40 % 3 7 11615
30 % 3 7 10680
Entity #23 | Chains: CH
RNA 3'-terminal phosphate cyclase-like protein protein, length: 411 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 14900
95 % 3 7 14536
90 % 3 7 14337
70 % 3 7 13451
50 % 3 7 12250
40 % 3 7 11512
30 % 3 7 10591
Entity #24 | Chains: CI
Bms1 protein, length: 1163 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13982
95 % 3 7 14497
90 % 3 7 13743
70 % 3 7 13424
50 % 3 7 12220
40 % 18 26 3328
30 % 18 26 3291
Entity #25 | Chains: CJ
Imp3 protein, length: 183 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 8 11286
95 % 3 8 12064
90 % 3 8 11929
70 % 3 8 11384
50 % 17 26 3346
40 % 17 26 3321
30 % 17 26 3285
Entity #26 | Chains: CK
Imp4 protein, length: 297 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 8 12012
95 % 3 8 13239
90 % 3 8 13078
70 % 3 8 12344
50 % 18 26 3332
40 % 18 26 3307
30 % 18 26 3224
Entity #27 | Chains: CL
Mpp10 protein, length: 785 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 14858
95 % 3 7 13840
90 % 3 7 14262
70 % 3 7 13397
50 % 3 7 12194
40 % 3 7 11465
30 % 3 7 10546
Entity #28 | Chains: CM
Sof1 protein, length: 446 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 14349
95 % 3 7 14684
90 % 3 7 13543
70 % 3 7 12765
50 % 3 7 11624
40 % 15 21 4187
30 % 15 21 4087
Entity #29 | Chains: CN,CO
Emg1 protein, length: 252 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 6099
95 % 3 7 6914
90 % 3 7 6912
70 % 23 32 1272
50 % 23 32 1313
40 % 23 32 1348
30 % 23 32 1382
Entity #3 | Chains: UC
Utp3 protein, length: 648 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 15048
95 % 3 7 14807
90 % 3 7 14594
70 % 3 7 13696
50 % 3 7 12481
40 % 3 7 11716
30 % 18 23 3631
Entity #30 | Chains: CP
KRR1 small subunit processome component protein, length: 322 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 8 10286
95 % 3 8 10444
90 % 3 8 10424
70 % 10 18 4798
50 % 10 18 4574
40 % 10 18 4496
30 % 10 18 4389
Entity #31 | Chains: CQ
Pre-rRNA-processing protein PNO1 protein, length: 259 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13999
95 % 3 7 13975
90 % 3 7 13784
70 % 3 7 12984
50 % 3 7 11803
40 % 3 7 11106
30 % 3 7 10220
Entity #32 | Chains: CR,CS
Kre33 protein, length: 1073 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 8 4763
95 % 3 8 5565
90 % 3 8 5600
70 % 3 8 5838
50 % 11 16 2676
40 % 11 16 2679
30 % 11 16 2666
Entity #33 | Chains: CT
Fcf2 protein, length: 203 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 14570
95 % 3 7 13881
90 % 3 7 13695
70 % 3 7 12898
50 % 3 7 11735
40 % 3 7 11029
30 % 3 7 10157
Entity #34 | Chains: Ca
40S ribosomal protein S1 protein, length: 255 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 5 20194
95 % 3 5 19107
90 % 3 5 18705
70 % 73 113 424
50 % 105 196 298
40 % 107 203 288
30 % 107 203 302
Entity #35 | Chains: Cb
40S ribosomal protein S4 protein, length: 264 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 5 21510
95 % 2 5 19158
90 % 2 5 19610
70 % 108 225 237
50 % 109 238 239
40 % 112 242 232
30 % 119 254 233
Entity #36 | Chains: Cc
40S ribosomal protein s5-like protein protein, length: 212 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 14028
95 % 3 7 14035
90 % 3 7 13841
70 % 38 123 526
50 % 114 248 223
40 % 114 248 227
30 % 114 248 236
Entity #37 | Chains: Cd
40S ribosomal protein S6 protein, length: 239 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 5 21388
95 % 2 5 19128
90 % 2 5 18732
70 % 2 5 17151
50 % 109 226 252
40 % 109 230 252
30 % 109 230 259
Entity #38 | Chains: Ce
40S ribosomal protein S7 protein, length: 203 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 14000
95 % 3 7 13976
90 % 3 7 14360
70 % 3 7 12985
50 % 110 234 243
40 % 110 234 247
30 % 112 237 248
Entity #39 | Chains: Cf
40S ribosomal protein S8 protein, length: 202 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 5 20640
95 % 2 5 19842
90 % 2 5 18132
70 % 74 117 410
50 % 110 235 238
40 % 110 239 238
30 % 110 239 245
Entity #4 | Chains: UD
Utp4 protein, length: 884 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 4 8 10630
95 % 4 8 11045
90 % 4 8 10958
70 % 4 8 10206
50 % 4 8 9484
40 % 4 8 9324
30 % 4 8 8431
Entity #40 | Chains: Cg
40S ribosomal protein s9-like protein protein, length: 190 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 14830
95 % 3 7 14397
90 % 3 7 14205
70 % 111 231 231
50 % 114 247 224
40 % 121 258 219
30 % 121 258 230
Entity #41 | Chains: Ch
40S ribosomal protein S13-like protein protein, length: 151 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 14652
95 % 3 7 14072
90 % 3 7 13869
70 % 112 237 226
50 % 114 244 226
40 % 122 257 221
30 % 122 257 231
Entity #42 | Chains: Ci
40S ribosomal protein S14-like protein protein, length: 150 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 14882
95 % 3 7 14505
90 % 36 102 647
70 % 112 243 217
50 % 112 244 227
40 % 112 244 230
30 % 112 244 238
Entity #43 | Chains: Cj
40S ribosomal protein S16-like protein protein, length: 143 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 14829
95 % 3 7 14396
90 % 3 7 14204
70 % 3 7 13349
50 % 112 237 235
40 % 119 248 228
30 % 119 249 235
Entity #44 | Chains: Ck
40S ribosomal protein S11-like protein protein, length: 161 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 5 20177
95 % 2 5 19385
90 % 2 5 18962
70 % 75 119 391
50 % 112 243 228
40 % 112 243 231
30 % 112 243 240
Entity #45 | Chains: Cm
40S ribosomal protein S22-like protein protein, length: 130 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 14832
95 % 3 7 14399
90 % 3 7 14207
70 % 112 247 218
50 % 115 251 220
40 % 116 252 224
30 % 583 927 21
Entity #46 | Chains: Cn
40S ribosomal protein s23-like protein protein, length: 145 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 14831
95 % 3 7 14398
90 % 3 7 14206
70 % 114 251 213
50 % 122 265 202
40 % 122 265 208
30 % 122 265 221
Entity #47 | Chains: Co
40S ribosomal protein S24 protein, length: 136 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 5 20618
95 % 2 5 19804
90 % 2 5 19355
70 % 2 5 17900
50 % 109 238 241
40 % 109 238 243
30 % 109 238 252
Entity #48 | Chains: Cp
40S ribosomal protein S28-like protein protein, length: 68 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 14833
95 % 3 7 14400
90 % 3 7 14208
70 % 111 237 227
50 % 120 251 218
40 % 120 252 222
30 % 121 253 232
Entity #49 | Chains: CU
Faf1 protein, length: 311 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 14707
95 % 3 7 14495
90 % 3 7 13970
70 % 3 7 13368
50 % 3 7 11955
40 % 3 7 11485
30 % 3 7 10340
Entity #5 | Chains: UF
Utp6 protein, length: 414 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 15016
95 % 3 7 14831
90 % 3 7 14618
70 % 3 7 13653
50 % 3 7 12443
40 % 3 7 11680
30 % 3 7 10733
Entity #50 | Chains: C1
35S ribosomal RNA rna, length: 2352 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
Entity #51 | Chains: C2
U3 snoRNA rna, length: 230 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
Entity #52 | Chains: UV
U3 small nucleolar RNA-associated protein 22 protein, length: 1171 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 4 32723
95 % 1 4 27456
90 % 1 4 26510
70 % 1 4 21424
50 % 1 4 21190
40 % 1 4 17459
30 % 1 4 17383
Entity #53 | Chains: CV
Rrp7 protein, length: 322 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 4 27845
95 % 1 4 28113
90 % 1 4 27124
70 % 1 4 21359
50 % 1 4 21446
40 % 1 4 17416
30 % 1 4 17589
Entity #54 | Chains: CW
Ribosome biogenesis protein ENP2 protein, length: 668 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 4 32929
95 % 2 4 27723
90 % 2 4 24807
70 % 2 4 22569
50 % 2 4 19943
40 % 2 4 19545
30 % 2 4 15067
Entity #55 | Chains: UT
Utp20 protein, length: 2612 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 4 27843
95 % 2 4 28112
90 % 2 4 27123
70 % 2 4 24603
50 % 2 4 21597
40 % 2 4 19760
30 % 2 4 17688
Entity #56 | Chains: UH
Utp8 protein, length: 930 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 6 18823
95 % 3 6 15815
90 % 3 6 16739
70 % 3 6 15537
50 % 3 6 13239
40 % 3 6 13091
30 % 3 6 11328
Entity #57 | Chains: UE,UI
Utp5 protein, length: 410 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 6 7986
95 % 3 6 8604
90 % 3 6 8558
70 % 3 6 7423
50 % 3 6 7783
40 % 3 6 7497
30 % 3 6 6986
Entity #58 | Chains: US
Noc4 protein, length: 549 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 6 17445
95 % 3 6 18358
90 % 3 6 18104
70 % 3 6 16719
50 % 3 6 15041
40 % 3 6 13969
30 % 3 6 11667
Entity #59 | Chains: Cl
Rps18 protein, length: 156 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 6 18732
95 % 3 6 16942
90 % 3 6 16598
70 % 107 224 236
50 % 109 233 240
40 % 117 247 229
30 % 117 247 237
Entity #6 | Chains: UG
Utp7 protein, length: 558 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 15046
95 % 3 7 14498
90 % 3 7 14305
70 % 3 7 13694
50 % 3 7 12479
40 % 15 21 4025
30 % 15 21 3921
Entity #60 | Chains: CX
Enp1 protein, length: 480 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 6 19694
95 % 3 6 18351
90 % 3 6 17982
70 % 3 6 16614
50 % 3 6 14940
40 % 3 6 13885
30 % 18 29 2918
Entity #61 | Chains: CY
U3 small nucleolar ribonucleoprotein protein lcp5-like protein protein, length: 381 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 3 36875
95 % 2 3 28308
90 % 2 3 27924
70 % 2 3 24754
50 % 2 3 21734
40 % 2 3 19873
30 % 2 3 17795
Entity #62 | Chains: CZ
Bfr2 protein, length: 609 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 4 29823
95 % 2 4 23385
90 % 2 4 22751
70 % 2 4 20810
50 % 2 4 18502
40 % 2 4 17026
30 % 2 4 15382
Entity #63 | Chains: UP
Utp16 protein, length: 364 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 6 18294
95 % 3 6 16230
90 % 3 6 15316
70 % 3 6 14874
50 % 3 6 13493
40 % 3 6 12580
30 % 3 6 11518
Entity #7 | Chains: UJ
UTP10 protein, length: 1802 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 8 13749
95 % 3 8 13519
90 % 3 8 13334
70 % 3 8 12589
50 % 3 8 11463
40 % 3 8 10776
30 % 3 8 9932
Entity #8 | Chains: UK
U3 small nucleolar RNA-associated protein 11 protein, length: 270 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 14353
95 % 3 7 14685
90 % 3 7 14479
70 % 3 7 13586
50 % 3 7 12378
40 % 3 7 11621
30 % 3 7 10684
Entity #9 | Chains: UL
Utp12 protein, length: 962 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 14485
95 % 3 7 13782
90 % 3 7 14053
70 % 3 7 12807
50 % 3 7 12024
40 % 17 25 3386
30 % 17 25 3336

Instructions

In the table for each entity, view a list of similar sequences by selecting the link associated with the percentage cutoff.



View more detailed documentation on the redundancy reduction and sequence clustering procedure used by RCSB PDB.

You can also use the structure comparison tool to compare any 2 given structures


ACTION - (A) Select for download / view details OR (B) Select two chains for comparison
Rank PDB ID Entity ID Chains Description Details Taxonomy EC Number
1 4V88 24 AW, CW 40S ribosomal protein S22-A 4932
2 4U4R 24 D2, d2 40S ribosomal protein S22-A 4932
3 4U3U 24 D2, d2 40S ribosomal protein S22-A 4932
4 5TBW 71 X, d2 40S ribosomal protein S22-A 4932
5 4U3M 24 D2, d2 40S ribosomal protein S22-A 4932
6 4U3N 24 D2, d2 40S ribosomal protein S22-A 4932
7 4U52 24 D2, d2 40S ribosomal protein S22-A 4932
8 4U4Q 24 D2, d2 40S ribosomal protein S22-A 4932
9 4U6F 24 D2, d2 40S ribosomal protein S22-A 4932
10 4U4U 24 D2, d2 40S ribosomal protein S22-A 4932
11 4U4Z 24 D2, d2 40S ribosomal protein S22-A 4932
12 4U4Y 24 D2, d2 40S ribosomal protein S22-A 4932
13 4U4N 24 D2, d2 40S ribosomal protein S22-A 4932
14 4U55 24 D2, d2 40S ribosomal protein S22-A 4932
15 5DAT 24 D2 40S ribosomal protein S22-A 4932
16 5DAT 80 d2 40S ribosomal protein S22-A 4932
17 5I4L 24 D2, d2 40S ribosomal protein S22-A 4932
18 4U51 24 D2, d2 40S ribosomal protein S22-A 4932
19 6HHQ 70 X, d2 40S ribosomal protein S22-A 4932
20 5OBM 68 D2, d2 40S ribosomal protein S22-A 4932
21 4U53 24 D2, d2 40S ribosomal protein S22-A 4932
22 5ON6 72 X, d2 40S ribosomal protein S22-A 4932
23 4U50 24 D2, d2 40S ribosomal protein S22-A 4932
24 5NDV 68 D2, d2 40S ribosomal protein S22-A 4932
25 5LYB 24 D2, d2 40S ribosomal protein S22-A 4932
26 4U56 24 D2, d2 40S ribosomal protein S22-A 4932
27 5TGA 24 D2, d2 40S ribosomal protein S22-A 4932
28 5MEI 71 X, d2 40S ribosomal protein S22-A 4932
29 5FCJ 24 D2, d2 40S ribosomal protein S22-A 4932
30 4U4O 24 D2, d2 40S ribosomal protein S22-A 4932
31 5DGV 24 D2, d2 40S ribosomal protein S22-A 4932
32 5DGE 24 D2, d2 40S ribosomal protein S22-A 4932
33 5NDW 17 D2, d2 40S ribosomal protein S22-A 4932
34 4BTS 18 AH, BH, CH, DH 40S RIBOSOMAL PROTEIN RPS22E 5911
35 5NDG 24 D2, d2 40S ribosomal protein S22-A 4932
36 5FCI 24 D2, d2 40S ribosomal protein S22-A 4932
37 5DC3 24 D2, d2 40S ribosomal protein S22-A 4932
38 5DGF 24 D2, d2 40S ribosomal protein S22-A 4932
39 4V5O 17 AH, BH RIBOSOMAL PROTEIN S8 CONTAINING PROTEIN 5911
40 5TGM 24 D2, d2 40S ribosomal protein S22-A 4932
41 4V7R 16 AO, CO 40S ribosomal protein S22-A 4932
42 5VYC 16 W1, W2, W3, W4, W5, W6 40S ribosomal protein S15a 9606
43 4KZZ 23 W 40S Ribosomal Protein S15A 9986
44 4KZX 23 W 40S ribosomal protein S15A 9986
45 4KZY 23 W 40S Ribosomal Protein S15A 9986
46 7K5I 29 W 40S ribosomal protein S15a 9606
47 7A1G 14 b 40S ribosomal protein S22-A 4932
48 7A09 14 D 40S ribosomal protein S15a 9606
49 6ZVH 29 W 40S ribosomal protein S15a 9606
50 6ZVI 26 E RPS22A isoform 1 4932
51 6ZVJ 15 f 40S ribosomal protein S15a 9606
52 6ZU9 14 b 40S ribosomal protein S22-A 4932
53 6ZU5 71 SW0 uS8 235221
54 6ZQA 51 DW 40S ribosomal protein S22-A 4932
55 6ZQB 60 DW 40S ribosomal protein S22-A 4932
56 6ZQC 60 DW 40S ribosomal protein S22-A 4932
57 6ZQD 57 DW 40S ribosomal protein S22-A 4932
58 6ZQE 53 DW 40S ribosomal protein S22-A 4932
59 6ZQF 37 DW 40S ribosomal protein S22-A 4932
60 6ZQG 29 DW 40S ribosomal protein S22-A 4932
61 6ZP4 14 D 40S ribosomal protein S15a 9606
62 6ZOJ 24 W 40S ribosomal protein S15a 9606
63 6ZOK 15 W 40S ribosomal protein S15a 9606
64 6ZON 15 f 40S ribosomal protein S15a 9606
65 6ZN5 22 W 40S ribosomal protein S15a 9606
66 6ZMW 31 J 40S ribosomal protein S15a 9606
67 6ZMO 77 SW 40S ribosomal protein S15a 9606
68 6ZMT 22 W 40S ribosomal protein S15a 9606
69 6ZME 77 SW 40S ribosomal protein S15a 9606
70 6ZMI 77 SW 40S ribosomal protein S15a 9606
71 6ZLW 22 W 40S ribosomal protein S15a 9606
72 6ZM7 77 SW 40S ribosomal protein S15a 9606
73 6ZJ3 15 SJ Ribosomal protein uS8 3039
74 6XIQ 69 AM RPS22A isoform 1 4932
75 6XIR 66 AM RPS22A isoform 1 4932
76 6ZCE 26 X 40S ribosomal protein S22-A 4932
77 6XA1 74 SW 40S ribosomal protein S15a 9606
78 6Z6J 28 SW 40S ribosomal protein S22-A 4932
79 6Z6K 28 SW 40S ribosomal protein S22-A 4932
80 6Z6L 75 SW 40S ribosomal protein S15a 9606
81 6Z6M 75 SW 40S ribosomal protein S15a 9606
82 6Z6N 75 SW 40S ribosomal protein S15a 9606
83 6WOO 70 WW uS8 4932
84 6WDR 21 W 40S ribosomal protein S22-A 4932
85 6YBW 9 J 40S ribosomal protein S15a 9606
86 6YAL 23 Y 40S ribosomal protein uS8 9986
87 6YAM 23 Y 40S ribosomal protein uS8 9986
88 6YAN 22 Y Ribosomal protein S15a 9986
89 6W2S 15 X uS8 9986
90 6W2T 14 X uS8 9986
91 6Y7C 22 W 40S ribosomal protein S22-A 4932
92 6Y57 71 SW 40S ribosomal protein S15a 9606
93 6Y2L 71 SW 40S ribosomal protein S15a 9606
94 6Y0G 72 SW 40S ribosomal protein S15a 9606
95 6XYW 64 Bg 40S ribosomal protein S15a-5 3702
96 6LQP 17 SX 40S ribosomal protein S22-B 4932
97 6LQQ 15 SX 40S ribosomal protein S22-B 4932
98 6LQR 15 SX 40S ribosomal protein S22-B 4932
99 6LQS 15 SX 40S ribosomal protein S22-B 4932
100 6LQT 15 SX 40S ribosomal protein S22-B 4932
101 6LQU 16 SX 40S ribosomal protein S22-B 4932
102 6TNU 26 b 40S ribosomal protein S22-A 4932
103 6UZ7 70 W 40S ribosomal protein S22 28985
104 6TB3 26 b 40S ribosomal protein S22-A 4932
105 6T83 24 Wb, x 40S ribosomal protein S22-A 4932
106 6T7T 26 SW 40S ribosomal protein S22-A 4932
107 6T7I 24 SW 40S ribosomal protein S22-A 4932
108 6T4Q 23 SW 40S ribosomal protein S22-A 4932
109 6SV4 41 b, bb, bc 40S ribosomal protein S22-A 4932
110 6SNT 24 W 40S ribosomal protein S22-A 4932
111 6SGC 24 X1 Ribosomal protein S15a 9986
112 6KE6 17 SX 40S ribosomal protein S22-B 4932
113 6S47 68 BX 40S ribosomal protein S22-A TRSSVLADALNAINNAEKTGKRQVLIRPSSKVIIKFLQVMQKHGYIGEFEYIDDHRSGK IVVQLNGRLNKCGVISPRFNVKIGDIEKWTANLLPARQFGYVILTTSAGIMDHEEARRKH VSGKILGFVY 4932
114 6RXT 41 Cm 40S ribosomal protein S22-like protein 209285
115 6RXU 45 Cm 40S ribosomal protein S22-like protein 209285
116 6RXV 45 Cm 40S ribosomal protein S22-like protein 209285
117 6RXX 26 Cm 40S ribosomal protein S22-like protein 209285
118 6RXY 40 Cm 40S ribosomal protein S22-like protein 209285
119 6RXZ 44 Cm 40S ribosomal protein S22-like protein 209285
120 6P5I 24 X uS8 9986
121 6P5J 24 X uS8 9986
122 6P5K 70 X uS8 9986
123 6P5N 70 X uS8 9986
124 6P4G 24 X uS8 9986
125 6P4H 25 X uS8 9986
126 6RM3 69 SW0 uS8 6039
127 6OM7 29 SW 40S ribosomal protein S15a 9606
128 6OLZ 69 BW 40S ribosomal protein S15a 9606
129 6OM0 29 SW 40S ribosomal protein S15a 9606
130 6OLE 29 SW 40S ribosomal protein S15a 9606
131 6OLF 29 SW 40S ribosomal protein S15a 9606
132 6OLG 72 BW 40S ribosomal protein S15a 9606
133 6OLI 29 SW 40S ribosomal protein S15a 9606
134 6OKK 11 K 40S ribosomal protein S15A 5833
135 6RBD 15 W 40S ribosomal protein S22-A 4932
136 6RBE 15 W 40S ribosomal protein S22-A 4932
137 6R7Q 82 TT Ribosomal protein S15a 9986
138 6R6G 50 TT Ribosomal protein S15a 9986
139 6R6P 66 TT Ribosomal protein S15a 9986
140 6R5Q 74 TT Ribosomal protein S15a 9986
141 6QZP 76 SW 40S ribosomal protein S15a 9606
142 6Q8Y 27 b 40S ribosomal protein S22-A 4932
143 6I7O 41 b, bb 40S ribosomal protein S22-A 4932
144 6IP5 75 3M 40S ribosomal protein S15a 9606
145 6IP6 74 3M 40S ribosomal protein S15a 9606
146 6IP8 74 3M 40S ribosomal protein S15a 9606
147 6MTB 73 WW 40S ribosomal protein S15a 9986
148 6MTC 72 WW 40S ribosomal protein S15a 9986
149 6MTD 74 WW uS8 9986
150 6MTE 73 WW uS8 9986
151 6HCQ 27 X2 Ribosomal protein S15a 9986
152 6HCJ 27 X2 Ribosomal protein S15a 9986
153 6HCM 24 X1 Ribosomal protein S15a 9986
154 6HCF 24 X1 Ribosomal protein S15a 9986
155 6GZ3 33 BW Ribosomal protein S15a 9986
156 6GZ4 36 BW ribosomal protein uS8 9986
157 6GZ5 33 BW ribosomal protein uS8 9986
158 6GSM 26 W 40S ribosomal protein S22 28985
159 6GSN 40 W 40S ribosomal protein S22 28985
160 6GQV 70 AM 40S ribosomal protein S22-A 4932
161 6GQ1 70 AM 40S ribosomal protein S22-A 4932
162 6GQB 70 AM 40S ribosomal protein S22-A 4932
163 6D9J 72 XX uS8 9986
164 6D90 73 XX uS8 9986
165 6G5H 14 W 40S ribosomal protein S15a 9606
166 6G5I 24 W 40S ribosomal protein S15a 9606
167 6G4S 19 W 40S ribosomal protein S15a 9606
168 6G4W 16 W 40S ribosomal protein S15a 9606
169 6G51 15 W 40S ribosomal protein S15a 9606
170 6G53 15 W 40S ribosomal protein S15a 9606
171 6G18 25 W 40S ribosomal protein S15a 9606
172 6FYX 26 W 40S ribosomal protein S22 28985
173 6FYY 26 W 40S ribosomal protein S22 28985
174 6FEC 29 a 40S ribosomal protein S15a 9606
175 6FAI 33 W 40S ribosomal protein S22-A 4932
176 6EML 24 b 40S ribosomal protein S22-A 4932
177 6EK0 76 SW 40S ribosomal protein S15a 9606
178 6AZ1 10 J ribosomal protein S8 5661
179 5OQL 45 w 40S ribosomal protein S22-like protein 209285
180 5OPT 22 e 40S ribosomal protein S15a, putative 5693
181 5WLC 13 LE rpS22_uS8 4932
182 5XYI 24 W Ribosomal protein S15a 5722
183 5XXU 24 W Ribosomal protein uS8 5811
184 5OA3 27 W 40S ribosomal protein S15a 9606
185 5WYJ 47 SX 40S ribosomal protein S22-A 4932
186 5WYK 43 SX 40S ribosomal protein S22-A 4932
187 5TZS 14 E rpS22_uS8 4932
188 5MC6 29 b 40S ribosomal protein S22-A 4932
189 5M1J 30 W2 40S ribosomal protein S22-A 4932
190 5LZS 73 WW uS8 9986
191 5LZT 74 WW uS8 9986
192 5LZU 73 WW uS8 9986
193 5LZV 74 WW uS8 9986
194 5LZW 74 WW uS8 9986
195 5LZX 74 WW uS8 9986
196 5LZY 72 WW uS8 9986
197 5LZZ 74 WW uS8 9986
198 5T2A 65 AJ uS8 5661
199 5T2C 57 AP 40S ribosomal protein S15a 9606
200 5LL6 14 b 40S ribosomal protein S22-A 4932
201 5LKS 75 SW 40S ribosomal protein S15a 9606
202 5K0Y 23 a ribosomal protein uS8 9986
203 5JUO 72 TB uS8 (yeast S22) 4932
204 5JUP 72 TB uS8 (yeast S22) 4932
205 5JUS 72 TB uS8 (yeast S22) 4932
206 5JUT 72 TB uS8 (yeast S22) 4932
207 5JUU 72 TB uS8 (yeast S22) 4932
208 5JPQ 32 z uS8 209285
209 5IT7 70 W 40S ribosomal protein S22 28985
210 5IT9 23 W Ribosomal protein uS8 28985
211 5FLX 24 W 40S RIBOSOMAL PROTEIN S15A 9986
212 3JBN 7 K 40S ribosomal protein uS8 5833
213 3JBO 29 K 40S ribosomal protein uS8 5833
214 3JBP 7 K 40S ribosomal protein uS8 5833
215 3JAP 26 W uS8 28985
216 3JAQ 26 W uS8 28985
217 3JAM 24 W uS8 28985
218 3JAN 66 SW Ribosomal protein uS8 SEE REMARK 999 9986
219 3JAJ 67 SW Ribosomal protein uS8 SEE REMARK 999 9986
220 3JAG 74 WW uS8 9986
221 3JAH 74 WW uS8 9986
222 3JAI 74 WW uS8 9986
223 5A2Q 25 W RIBOSOMAL PROTEIN US8 9606
224 4UG0 77 SW 40S RIBOSOMAL PROTEIN S15A 9606
225 5AJ0 72 BW 40S ribosomal protein S15a 9606
226 4UER 18 H US8 4934
227 4D61 24 W 40S RIBOSOMAL PROTEIN S15A 9986
228 4D5L 24 W 40S RIBOSOMAL PROTEIN US8 9986
229 4V3P 27 SH Ribosomal protein S15 4565
230 3J81 24 W uS8 28985
231 3J80 14 W uS8 28985
232 3J7P 72 SW Ribosomal protein uS8 9823
233 3J7R 73 SW Ribosomal protein uS8 9823
234 4UJC 73 CW 40S RIBOSOMAL PROTEIN US8 9986
235 4UJD 73 CW 40S RIBOSOMAL PROTEIN US8 9986
236 3J7A 11 K 40S ribosomal protein uS8 5833
237 3J77 68 22 40S ribosomal protein S22 4932
238 3J78 68 22 40S ribosomal protein S22 4932
239 3J6X 69 22 40S ribosomal protein S22 4932
240 3J6Y 69 22 40S ribosomal protein S22 4932
241 4UJE 27 BW 40S RIBOSOMAL PROTEIN S15A 9986
242 4V92 25 BW US8 28985
243 4V7E 24 BW 40S ribosomal protein S8 4565
244 4V8Y 31 AW 40S RIBOSOMAL PROTEIN S22-A 4932
245 4V8Z 31 AW 40S RIBOSOMAL PROTEIN S22-A 4932
246 4V6W 32 AW 40S ribosomal protein S15Aa 7227
247 4V6X 32 AW 40S ribosomal protein S15a 9606
248 4V8M 18 AJ 40S RIBOSOMAL PROTEIN S15A, PUTATIVE 185431
249 4V6I 9 AH 40S ribosomal protein rpS22 (S8p) 4932
250 4V7H 7 AH 40S ribosomal protein S22(A) 5541
251 4V5Z 15 Ah 40S Ribosomal protein S15ae 9612
252 4V4B 8 AH 40S ribosomal protein S22 4932