6RXV

Cryo-EM structure of the 90S pre-ribosome (Kre33-Noc4) from Chaetomium thermophilum, state B2


Sequence Similarity Clusters for the Entities in PDB 6RXV

Entity #1 | Chains: UA
Periodic tryptophan protein 2-like protein protein, length: 904 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 14662
95 % 3 7 14190
90 % 3 7 14262
70 % 3 7 13413
50 % 11 19 4536
40 % 11 19 4452
30 % 11 19 4354
Entity #10 | Chains: UM
Utp13 protein, length: 912 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13605
95 % 3 7 13584
90 % 3 7 13399
70 % 3 7 12628
50 % 3 7 11511
40 % 3 7 10808
30 % 3 7 9974
Entity #11 | Chains: UN
Utp14 protein, length: 938 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 14103
95 % 3 7 13374
90 % 3 7 13408
70 % 3 7 12637
50 % 3 7 11347
40 % 3 7 10812
30 % 3 7 9978
Entity #12 | Chains: UO
Utp15 protein, length: 557 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 14102
95 % 3 7 13592
90 % 3 7 13195
70 % 3 7 12438
50 % 3 7 11346
40 % 3 7 10639
30 % 11 17 4793
Entity #13 | Chains: UQ
Utp17 protein, length: 960 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 14667
95 % 3 7 14483
90 % 3 7 14270
70 % 3 7 13421
50 % 3 7 12266
40 % 3 7 11498
30 % 3 7 10578
Entity #14 | Chains: UR
Utp18 protein, length: 618 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13935
95 % 3 7 14236
90 % 3 7 14043
70 % 3 7 13196
50 % 3 7 12029
40 % 3 7 11295
30 % 11 19 4197
Entity #15 | Chains: UU
Utp21 protein, length: 1049 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 14101
95 % 3 7 13373
90 % 3 7 13194
70 % 3 7 12437
50 % 3 7 11345
40 % 3 7 10638
30 % 3 7 9834
Entity #16 | Chains: UX
Utp24 protein, length: 193 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 8 13041
95 % 3 8 12331
90 % 3 8 12209
70 % 3 8 11595
50 % 11 20 4297
40 % 11 20 4222
30 % 11 20 4134
Entity #17 | Chains: UZ
Utp30 protein, length: 391 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13936
95 % 3 7 14237
90 % 3 7 14044
70 % 3 7 13197
50 % 3 7 12030
40 % 3 7 11296
30 % 3 7 10411
Entity #18 | Chains: CA,CB
Nop1 protein, length: 313 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 5430
95 % 3 7 6428
90 % 3 7 6473
70 % 3 7 6396
50 % 11 19 2115
40 % 11 19 2136
30 % 11 19 2169
Entity #19 | Chains: CC
Nop56 protein, length: 523 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 14104
95 % 3 7 13375
90 % 3 7 13196
70 % 3 7 12638
50 % 11 19 4508
40 % 19 31 2660
30 % 19 31 2648
Entity #2 | Chains: UB
Utp2 protein, length: 907 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13995
95 % 3 7 14351
90 % 3 7 14142
70 % 3 7 13305
50 % 3 7 12142
40 % 3 7 11389
30 % 3 7 10494
Entity #20 | Chains: CD
Nop58 protein, length: 582 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13917
95 % 3 7 13646
90 % 3 7 13470
70 % 3 7 13157
50 % 3 7 11990
40 % 3 7 11261
30 % 3 7 10387
Entity #21 | Chains: CE,CF
Snu13 protein, length: 127 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 5530
95 % 3 7 6645
90 % 3 7 6671
70 % 3 7 6591
50 % 20 42 1111
40 % 21 43 1097
30 % 20 42 1187
Entity #22 | Chains: CG
Rrp9 protein, length: 630 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13916
95 % 3 7 14188
90 % 3 7 13996
70 % 3 7 13156
50 % 3 7 11989
40 % 3 7 11260
30 % 3 7 10386
Entity #23 | Chains: CH
RNA 3'-terminal phosphate cyclase-like protein protein, length: 411 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 14485
95 % 3 7 14146
90 % 3 7 13959
70 % 3 7 13126
50 % 3 7 11954
40 % 3 7 11228
30 % 3 7 10361
Entity #24 | Chains: CI
Bms1 protein, length: 1163 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13637
95 % 3 7 14189
90 % 3 7 13997
70 % 3 7 12697
50 % 3 7 11991
40 % 11 19 4449
30 % 11 19 4353
Entity #25 | Chains: CJ
Imp3 protein, length: 183 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 8 10470
95 % 3 8 11747
90 % 3 8 12500
70 % 3 8 11113
50 % 11 20 4217
40 % 11 20 4146
30 % 11 20 4060
Entity #26 | Chains: CK
Imp4 protein, length: 297 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 8 12974
95 % 3 8 11026
90 % 3 8 12404
70 % 3 8 11761
50 % 11 19 4532
40 % 11 19 4448
30 % 11 19 4352
Entity #27 | Chains: CL
Mpp10 protein, length: 785 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13759
95 % 3 7 14359
90 % 3 7 13711
70 % 3 7 12909
50 % 3 7 12150
40 % 3 7 11048
30 % 3 7 10198
Entity #28 | Chains: CM
Sof1 protein, length: 446 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 14636
95 % 3 7 13989
90 % 3 7 14220
70 % 3 7 12795
50 % 3 7 12230
40 % 11 17 4882
30 % 11 17 4876
Entity #29 | Chains: CN,CO
Emg1 protein, length: 252 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 5862
95 % 3 7 6684
90 % 3 7 6508
70 % 16 25 1646
50 % 16 25 1680
40 % 16 25 1697
30 % 16 25 1740
Entity #3 | Chains: UC
Utp3 protein, length: 648 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 14231
95 % 3 7 13413
90 % 3 7 13823
70 % 3 7 12695
50 % 3 7 11568
40 % 3 7 10671
30 % 11 16 5150
Entity #30 | Chains: CP
KRR1 small subunit processome component protein, length: 322 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 8 9498
95 % 3 8 10072
90 % 3 8 10565
70 % 7 15 5485
50 % 7 15 5498
40 % 7 15 5349
30 % 7 15 5165
Entity #31 | Chains: CQ
Pre-rRNA-processing protein PNO1 protein, length: 259 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13676
95 % 3 7 13736
90 % 3 7 13206
70 % 3 7 12777
50 % 3 7 11352
40 % 3 7 10646
30 % 3 7 9841
Entity #32 | Chains: CR,CS
Kre33 protein, length: 1073 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 8 4893
95 % 3 8 5487
90 % 3 8 5354
70 % 3 8 5548
50 % 9 14 2989
40 % 9 14 2977
30 % 9 14 2964
Entity #33 | Chains: CT
Fcf2 protein, length: 203 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 14151
95 % 3 7 13336
90 % 3 7 13290
70 % 3 7 12519
50 % 3 7 11434
40 % 3 7 10637
30 % 3 7 9909
Entity #34 | Chains: Ca
40S ribosomal protein S1 protein, length: 255 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 5 19723
95 % 3 5 18745
90 % 3 5 18355
70 % 62 102 445
50 % 64 108 459
40 % 92 188 311
30 % 92 188 321
Entity #35 | Chains: Cb
40S ribosomal protein S4 protein, length: 264 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 5 19298
95 % 2 5 18135
90 % 2 5 17776
70 % 92 210 242
50 % 94 220 239
40 % 94 220 241
30 % 101 231 241
Entity #36 | Chains: Cc
40S ribosomal protein s5-like protein protein, length: 212 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13482
95 % 3 7 13335
90 % 3 7 13151
70 % 32 117 536
50 % 96 230 227
40 % 96 230 231
30 % 96 230 242
Entity #37 | Chains: Cd
40S ribosomal protein S6 protein, length: 239 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 5 21715
95 % 2 5 19984
90 % 2 5 19545
70 % 31 107 583
50 % 93 211 261
40 % 93 216 259
30 % 93 216 271
Entity #38 | Chains: Ce
40S ribosomal protein S7 protein, length: 203 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13675
95 % 3 7 13735
90 % 3 7 13551
70 % 3 7 12776
50 % 93 217 250
40 % 93 217 252
30 % 95 220 254
Entity #39 | Chains: Cf
40S ribosomal protein S8 protein, length: 202 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 5 19988
95 % 2 5 19985
90 % 2 5 18676
70 % 63 106 433
50 % 94 219 244
40 % 94 223 239
30 % 94 223 253
Entity #4 | Chains: UD
Utp4 protein, length: 884 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 4 8 10168
95 % 4 8 10492
90 % 4 8 10435
70 % 4 8 10068
50 % 4 8 9370
40 % 4 8 8942
30 % 4 8 8311
Entity #40 | Chains: Cg
40S ribosomal protein s9-like protein protein, length: 190 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13648
95 % 3 7 13681
90 % 3 7 13503
70 % 94 214 240
50 % 96 229 229
40 % 103 240 220
30 % 103 240 227
Entity #41 | Chains: Ch
40S ribosomal protein S13-like protein protein, length: 151 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 14340
95 % 3 7 13879
90 % 3 7 13677
70 % 94 219 236
50 % 96 226 233
40 % 103 238 224
30 % 103 238 230
Entity #42 | Chains: Ci
40S ribosomal protein S14-like protein protein, length: 150 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 14455
95 % 3 7 14091
90 % 32 98 655
70 % 96 227 225
50 % 96 228 230
40 % 96 228 232
30 % 96 228 244
Entity #43 | Chains: Cj
40S ribosomal protein S16-like protein protein, length: 143 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 14191
95 % 3 7 13559
90 % 3 7 13259
70 % 3 7 12606
50 % 94 219 241
40 % 94 219 243
30 % 101 231 240
Entity #44 | Chains: Ck
40S ribosomal protein S11-like protein protein, length: 161 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 5 21341
95 % 2 5 19345
90 % 2 5 18955
70 % 64 108 420
50 % 95 226 232
40 % 95 226 235
30 % 95 226 246
Entity #45 | Chains: Cm
40S ribosomal protein S22-like protein protein, length: 130 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13624
95 % 3 7 14092
90 % 3 7 14103
70 % 94 229 227
50 % 96 231 228
40 % 104 243 215
30 % 541 881 22
Entity #46 | Chains: Cn
40S ribosomal protein s23-like protein protein, length: 145 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 14512
95 % 3 7 13837
90 % 3 7 14005
70 % 96 233 218
50 % 103 246 211
40 % 103 246 214
30 % 103 246 223
Entity #47 | Chains: Co
40S ribosomal protein S24 protein, length: 136 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 5 21287
95 % 2 5 19248
90 % 2 5 18861
70 % 63 108 428
50 % 92 221 246
40 % 92 221 246
30 % 92 221 259
Entity #48 | Chains: Cp
40S ribosomal protein S28-like protein protein, length: 68 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 14456
95 % 3 7 14302
90 % 3 7 13452
70 % 94 220 233
50 % 103 234 223
40 % 103 235 226
30 % 103 235 232
Entity #49 | Chains: CU
Faf1 protein, length: 311 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13856
95 % 3 7 14219
90 % 3 7 14026
70 % 3 7 13061
50 % 3 7 11898
40 % 3 7 11169
30 % 3 7 10305
Entity #5 | Chains: UF
Utp6 protein, length: 414 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 14134
95 % 3 7 13437
90 % 3 7 13256
70 % 3 7 12490
50 % 3 7 11404
40 % 3 7 10695
30 % 3 7 9884
Entity #50 | Chains: C1
35S ribosomal RNA rna, length: 2352 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
Entity #51 | Chains: C2
U3 snoRNA rna, length: 230 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
Entity #52 | Chains: UV
U3 small nucleolar RNA-associated protein 22 protein, length: 1171 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 4 27100
95 % 1 4 27424
90 % 1 4 26484
70 % 1 4 24078
50 % 1 4 21148
40 % 1 4 19316
30 % 1 4 17305
Entity #53 | Chains: CV
Rrp7 protein, length: 322 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 4 27102
95 % 1 4 27425
90 % 1 4 22834
70 % 1 4 23894
50 % 1 4 20990
40 % 1 4 17034
30 % 1 4 17207
Entity #54 | Chains: CW
Ribosome biogenesis protein ENP2 protein, length: 668 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 4 30264
95 % 2 4 24509
90 % 2 4 23761
70 % 2 4 21737
50 % 2 4 19192
40 % 2 4 17588
30 % 2 4 15878
Entity #55 | Chains: UT
Utp20 protein, length: 2612 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 4 27099
95 % 2 4 27423
90 % 2 4 26483
70 % 2 4 24077
50 % 2 4 21147
40 % 2 4 19315
30 % 2 4 17304
Entity #56 | Chains: UH
Utp8 protein, length: 930 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 6 17001
95 % 3 6 18045
90 % 3 6 17693
70 % 3 6 16383
50 % 3 6 14773
40 % 3 6 13698
30 % 3 6 12477
Entity #57 | Chains: UE,UI
Utp5 protein, length: 410 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 6 7724
95 % 3 6 8358
90 % 3 6 8285
70 % 3 6 8072
50 % 3 6 7585
40 % 3 6 7335
30 % 3 6 6874
Entity #58 | Chains: US
Noc4 protein, length: 549 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 6 18203
95 % 3 6 16441
90 % 3 6 15734
70 % 3 6 15209
50 % 3 6 13647
40 % 3 6 12731
30 % 3 6 11634
Entity #59 | Chains: Cl
Rps18 protein, length: 156 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 6 18684
95 % 3 6 17175
90 % 3 6 16839
70 % 89 207 244
50 % 91 216 245
40 % 98 228 233
30 % 98 229 243
Entity #6 | Chains: UG
Utp7 protein, length: 558 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 14661
95 % 3 7 14474
90 % 3 7 14261
70 % 3 7 13159
50 % 3 7 12260
40 % 11 17 4956
30 % 11 17 4811
Entity #60 | Chains: CX
Enp1 protein, length: 480 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 6 17000
95 % 3 6 16172
90 % 3 6 15885
70 % 3 6 14838
50 % 3 6 13471
40 % 3 6 12549
30 % 11 22 3657
Entity #61 | Chains: CY
U3 small nucleolar ribonucleoprotein protein lcp5-like protein protein, length: 381 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 3 37171
95 % 2 3 29333
90 % 2 3 28261
70 % 2 3 25551
50 % 2 3 22391
40 % 2 3 20441
30 % 2 3 18308
Entity #62 | Chains: CZ
Bfr2 protein, length: 609 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 4 26555
95 % 2 4 26717
90 % 2 4 25863
70 % 2 4 23511
50 % 2 4 20693
40 % 2 4 18926
30 % 2 4 16987
Entity #63 | Chains: UP
Utp16 protein, length: 364 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 6 18204
95 % 3 6 16646
90 % 3 6 16136
70 % 3 6 15211
50 % 3 6 13648
40 % 3 6 12732
30 % 3 6 11635
Entity #7 | Chains: UJ
UTP10 protein, length: 1802 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 8 12817
95 % 3 8 12172
90 % 3 8 12180
70 % 3 8 12124
50 % 3 8 10558
40 % 3 8 10051
30 % 3 8 9246
Entity #8 | Chains: UK
U3 small nucleolar RNA-associated protein 11 protein, length: 270 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 14633
95 % 3 7 14430
90 % 3 7 14217
70 % 3 7 13381
50 % 3 7 12223
40 % 3 7 11462
30 % 3 7 10547
Entity #9 | Chains: UL
Utp12 protein, length: 962 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 14230
95 % 3 7 14182
90 % 3 7 13467
70 % 3 7 12693
50 % 3 7 11850
40 % 11 19 4332
30 % 11 19 4246

Instructions

In the table for each entity, view a list of similar sequences by selecting the link associated with the percentage cutoff.



View more detailed documentation on the redundancy reduction and sequence clustering procedure used by RCSB PDB.

You can also use the structure comparison tool to compare any 2 given structures

ACTION - (A) Select for download / view details OR (B) Select two chains for comparison
Rank PDB ID Entity ID Chains Description Details Taxonomy EC Number
1 1I6U 2 A, B 30S RIBOSOMAL PROTEIN S8P 2190
2 4V88 24 AW, CW 40S ribosomal protein S22-A 4932
3 4U4R 24 D2, d2 40S ribosomal protein S22-A 4932
4 4U3U 24 D2, d2 40S ribosomal protein S22-A 4932
5 5TBW 71 X, d2 40S ribosomal protein S22-A 4932
6 4U3M 24 D2, d2 40S ribosomal protein S22-A 4932
7 4U3N 24 D2, d2 40S ribosomal protein S22-A 4932
8 4U52 24 D2, d2 40S ribosomal protein S22-A 4932
9 4U4Q 24 D2, d2 40S ribosomal protein S22-A 4932
10 4U6F 24 D2, d2 40S ribosomal protein S22-A 4932
11 4U4U 24 D2, d2 40S ribosomal protein S22-A 4932
12 4U4Z 24 D2, d2 40S ribosomal protein S22-A 4932
13 4U4Y 24 D2, d2 40S ribosomal protein S22-A 4932
14 4U4N 24 D2, d2 40S ribosomal protein S22-A 4932
15 4U55 24 D2, d2 40S ribosomal protein S22-A 4932
16 5DAT 24 D2 40S ribosomal protein S22-A 4932
17 5DAT 80 d2 40S ribosomal protein S22-A 4932
18 5I4L 24 D2, d2 40S ribosomal protein S22-A 4932
19 4U51 24 D2, d2 40S ribosomal protein S22-A 4932
20 6HHQ 70 X, d2 40S ribosomal protein S22-A 4932
21 5OBM 68 D2, d2 40S ribosomal protein S22-A 4932
22 4U53 24 D2, d2 40S ribosomal protein S22-A 4932
23 5ON6 72 X, d2 40S ribosomal protein S22-A 4932
24 4U50 24 D2, d2 40S ribosomal protein S22-A 4932
25 5NDV 68 D2, d2 40S ribosomal protein S22-A 4932
26 5LYB 24 D2, d2 40S ribosomal protein S22-A 4932
27 4U56 24 D2, d2 40S ribosomal protein S22-A 4932
28 5TGA 24 D2, d2 40S ribosomal protein S22-A 4932
29 5MEI 71 X, d2 40S ribosomal protein S22-A 4932
30 5FCJ 24 D2, d2 40S ribosomal protein S22-A 4932
31 4U4O 24 D2, d2 40S ribosomal protein S22-A 4932
32 5DGV 24 D2, d2 40S ribosomal protein S22-A 4932
33 5DGE 24 D2, d2 40S ribosomal protein S22-A 4932
34 5NDW 17 D2, d2 40S ribosomal protein S22-A 4932
35 4BTS 18 AH, BH, CH, DH 40S RIBOSOMAL PROTEIN RPS22E 5911
36 5NDG 24 D2, d2 40S ribosomal protein S22-A 4932
37 5FCI 24 D2, d2 40S ribosomal protein S22-A 4932
38 5DC3 24 D2, d2 40S ribosomal protein S22-A 4932
39 5DGF 24 D2, d2 40S ribosomal protein S22-A 4932
40 4V5O 17 AH, BH RIBOSOMAL PROTEIN S8 CONTAINING PROTEIN 5911
41 5TGM 24 D2, d2 40S ribosomal protein S22-A 4932
42 4V7R 16 AO, CO 40S ribosomal protein S22-A 4932
43 5VYC 16 W1, W2, W3, W4, W5, W6 40S ribosomal protein S15a 9606
44 4KZZ 23 W 40S Ribosomal Protein S15A 9986
45 4KZX 23 W 40S ribosomal protein S15A 9986
46 4KZY 23 W 40S Ribosomal Protein S15A 9986
47 6ZVH 29 W 40S ribosomal protein S15a 9606
48 6ZVI 26 E RPS22A isoform 1 4932
49 6ZP4 14 D 40S ribosomal protein S15a 9606
50 6ZOJ 24 W 40S ribosomal protein S15a 9606
51 6ZOK 15 W 40S ribosomal protein S15a 9606
52 6ZON 15 f 40S ribosomal protein S15a 9606
53 6ZN5 22 W 40S ribosomal protein S15a 9606
54 6ZMO 77 SW 40S ribosomal protein S15a 9606
55 6ZMT 22 W 40S ribosomal protein S15a 9606
56 6ZME 77 SW 40S ribosomal protein S15a 9606
57 6ZMI 77 SW 40S ribosomal protein S15a 9606
58 6ZLW 22 W 40S ribosomal protein S15a 9606
59 6ZM7 77 SW 40S ribosomal protein S15a 9606
60 6XIQ 69 AM RPS22A isoform 1 4932
61 6XIR 66 AM RPS22A isoform 1 4932
62 6Z6J 28 SW 40S ribosomal protein S22-A 4932
63 6Z6K 28 SW 40S ribosomal protein S22-A 4932
64 6Z6L 75 SW 40S ribosomal protein S15a 9606
65 6Z6M 75 SW 40S ribosomal protein S15a 9606
66 6Z6N 75 SW 40S ribosomal protein S15a 9606
67 6YBW 9 J 40S ribosomal protein S15a 9606
68 6YAL 23 Y 40S ribosomal protein uS8 9986
69 6YAM 23 Y 40S ribosomal protein uS8 9986
70 6YAN 22 Y Ribosomal protein S15a 9986
71 6W2S 15 X uS8 9986
72 6W2T 14 X uS8 9986
73 6Y7C 22 W 40S ribosomal protein S22-A 4932
74 6Y57 71 SW 40S ribosomal protein S15a 9606
75 6Y2L 71 SW 40S ribosomal protein S15a 9606
76 6Y0G 72 SW 40S ribosomal protein S15a 9606
77 6LQP 17 SX 40S ribosomal protein S22-B 4932
78 6LQQ 15 SX 40S ribosomal protein S22-B 4932
79 6LQR 15 SX 40S ribosomal protein S22-B 4932
80 6LQS 15 SX 40S ribosomal protein S22-B 4932
81 6LQT 15 SX 40S ribosomal protein S22-B 4932
82 6LQU 16 SX 40S ribosomal protein S22-B 4932
83 6TNU 26 b 40S ribosomal protein S22-A 4932
84 6TMF 10 J 30S ribosomal protein S8 2264
85 6TH6 10 Aj 30S ribosomal protein S8 311400
86 6UZ7 70 W 40S ribosomal protein S22 28985
87 6TB3 26 b 40S ribosomal protein S22-A 4932
88 6T83 24 Wb, x 40S ribosomal protein S22-A 4932
89 6T7T 26 SW 40S ribosomal protein S22-A 4932
90 6T7I 24 SW 40S ribosomal protein S22-A 4932
91 6T4Q 23 SW 40S ribosomal protein S22-A 4932
92 6SW9 10 I 30S ribosomal protein S8 29292
93 6SWC 10 I 30S ribosomal protein S8 29292
94 6SWD 9 I 30S ribosomal protein S8 29292
95 6SV4 41 b, bb, bc 40S ribosomal protein S22-A 4932
96 6SNT 24 W 40S ribosomal protein S22-A 4932
97 6SKF 10 Aj 30S ribosomal protein S8 311400
98 6SKG 10 Aj 30S ribosomal protein S8 311400
99 6SGC 24 X1 Ribosomal protein S15a 9986
100 6KE6 17 SX 40S ribosomal protein S22-B 4932
101 6S47 68 BX 40S ribosomal protein S22-A TRSSVLADALNAINNAEKTGKRQVLIRPSSKVIIKFLQVMQKHGYIGEFEYIDDHRSGK IVVQLNGRLNKCGVISPRFNVKIGDIEKWTANLLPARQFGYVILTTSAGIMDHEEARRKH VSGKILGFVY 4932
102 6RXT 41 Cm 40S ribosomal protein S22-like protein 209285
103 6RXU 45 Cm 40S ribosomal protein S22-like protein 209285
104 6RXV 45 Cm 40S ribosomal protein S22-like protein 209285
105 6RXX 26 Cm 40S ribosomal protein S22-like protein 209285
106 6RXY 40 Cm 40S ribosomal protein S22-like protein 209285
107 6RXZ 44 Cm 40S ribosomal protein S22-like protein 209285
108 6P5I 24 X uS8 9986
109 6P5J 24 X uS8 9986
110 6P5K 70 X uS8 9986
111 6P5N 70 X uS8 9986
112 6P4G 24 X uS8 9986
113 6P4H 25 X uS8 9986
114 6OM7 29 SW 40S ribosomal protein S15a 9606
115 6OLZ 69 BW 40S ribosomal protein S15a 9606
116 6OM0 29 SW 40S ribosomal protein S15a 9606
117 6OLE 29 SW 40S ribosomal protein S15a 9606
118 6OLF 29 SW 40S ribosomal protein S15a 9606
119 6OLG 72 BW 40S ribosomal protein S15a 9606
120 6OLI 29 SW 40S ribosomal protein S15a 9606
121 6OKK 11 K 40S ribosomal protein S15A 5833
122 6RBD 15 W 40S ribosomal protein S22-A 4932
123 6RBE 15 W 40S ribosomal protein S22-A 4932
124 6R7Q 82 TT Ribosomal protein S15a 9986
125 6R6G 50 TT Ribosomal protein S15a 9986
126 6R6P 66 TT Ribosomal protein S15a 9986
127 6R5Q 74 TT Ribosomal protein S15a 9986
128 6QZP 76 SW 40S ribosomal protein S15a 9606
129 6Q8Y 27 b 40S ribosomal protein S22-A 4932
130 6I7O 41 b, bb 40S ribosomal protein S22-A 4932
131 6IP5 75 3M 40S ribosomal protein S15a 9606
132 6IP6 74 3M 40S ribosomal protein S15a 9606
133 6IP8 74 3M 40S ribosomal protein S15a 9606
134 6MTB 73 WW 40S ribosomal protein S15a 9986
135 6MTC 72 WW 40S ribosomal protein S15a 9986
136 6MTD 74 WW uS8 9986
137 6MTE 73 WW uS8 9986
138 6HCQ 27 X2 Ribosomal protein S15a 9986
139 6HCJ 27 X2 Ribosomal protein S15a 9986
140 6HCM 24 X1 Ribosomal protein S15a 9986
141 6HCF 24 X1 Ribosomal protein S15a 9986
142 6GZ3 33 BW Ribosomal protein S15a 9986
143 6GZ4 36 BW ribosomal protein uS8 9986
144 6GZ5 33 BW ribosomal protein uS8 9986
145 6GSM 26 W 40S ribosomal protein S22 28985
146 6GSN 40 W 40S ribosomal protein S22 28985
147 6GQV 70 AM 40S ribosomal protein S22-A 4932
148 6GQ1 70 AM 40S ribosomal protein S22-A 4932
149 6GQB 70 AM 40S ribosomal protein S22-A 4932
150 6D9J 72 XX uS8 9986
151 6D90 73 XX uS8 9986
152 6G5H 14 W 40S ribosomal protein S15a 9606
153 6G5I 24 W 40S ribosomal protein S15a 9606
154 6G4S 19 W 40S ribosomal protein S15a 9606
155 6G4W 16 W 40S ribosomal protein S15a 9606
156 6G51 15 W 40S ribosomal protein S15a 9606
157 6G53 15 W 40S ribosomal protein S15a 9606
158 6G18 25 W 40S ribosomal protein S15a 9606
159 6FYX 26 W 40S ribosomal protein S22 28985
160 6FYY 26 W 40S ribosomal protein S22 28985
161 6FEC 29 a 40S ribosomal protein S15a 9606
162 6FAI 33 W 40S ribosomal protein S22-A 4932
163 6EML 24 b 40S ribosomal protein S22-A 4932
164 6EK0 76 SW 40S ribosomal protein S15a 9606
165 6AZ1 10 J ribosomal protein S8 5661
166 5OQL 45 w 40S ribosomal protein S22-like protein 209285
167 5OPT 22 e 40S ribosomal protein S15a, putative 5693
168 5WLC 13 LE rpS22_uS8 4932
169 5XYI 24 W Ribosomal protein S15a 5722
170 5XXU 24 W Ribosomal protein uS8 5811
171 5OA3 27 W 40S ribosomal protein S15a 9606
172 5WYJ 47 SX 40S ribosomal protein S22-A 4932
173 5WYK 43 SX 40S ribosomal protein S22-A 4932
174 5TZS 14 E rpS22_uS8 4932
175 5MC6 29 b 40S ribosomal protein S22-A 4932
176 5M1J 30 W2 40S ribosomal protein S22-A 4932
177 5LZS 73 WW uS8 9986
178 5LZT 74 WW uS8 9986
179 5LZU 73 WW uS8 9986
180 5LZV 74 WW uS8 9986
181 5LZW 74 WW uS8 9986
182 5LZX 74 WW uS8 9986
183 5LZY 72 WW uS8 9986
184 5LZZ 74 WW uS8 9986
185 5T2A 65 AJ uS8 5661
186 5T2C 57 AP 40S ribosomal protein S15a 9606
187 5LL6 14 b 40S ribosomal protein S22-A 4932
188 5LKS 75 SW 40S ribosomal protein S15a 9606
189 5K0Y 23 a ribosomal protein uS8 9986
190 5JUO 72 TB uS8 (yeast S22) 4932
191 5JUP 72 TB uS8 (yeast S22) 4932
192 5JUS 72 TB uS8 (yeast S22) 4932
193 5JUT 72 TB uS8 (yeast S22) 4932
194 5JUU 72 TB uS8 (yeast S22) 4932
195 5JPQ 32 z uS8 209285
196 5JB3 15 I 30S ribosomal protein S8 30S ribosomal protein uS8 model from Pyrococcus furiosus (PDB code 4V6U) used for fitting 29292
197 5JBH 26 I 30S ribosomal protein uS8 30S ribosomal protein uS8 model from Pyrococcus furiosus (PDB code 4V6U) used for fitting 29292
198 5IT7 70 W 40S ribosomal protein S22 28985
199 5IT9 23 W Ribosomal protein uS8 28985
200 5FLX 24 W 40S RIBOSOMAL PROTEIN S15A 9986
201 3JBN 7 K 40S ribosomal protein uS8 5833
202 3JBO 29 K 40S ribosomal protein uS8 5833
203 3JBP 7 K 40S ribosomal protein uS8 5833
204 3JAP 26 W uS8 28985
205 3JAQ 26 W uS8 28985
206 3JAM 24 W uS8 28985
207 3JAN 66 SW Ribosomal protein uS8 SEE REMARK 999 9986
208 3JAJ 67 SW Ribosomal protein uS8 SEE REMARK 999 9986
209 3JAG 74 WW uS8 9986
210 3JAH 74 WW uS8 9986
211 3JAI 74 WW uS8 9986
212 5A2Q 25 W RIBOSOMAL PROTEIN US8 9606
213 4UG0 77 SW 40S RIBOSOMAL PROTEIN S15A 9606
214 5AJ0 72 BW 40S ribosomal protein S15a 9606
215 4UER 18 H US8 4934
216 4D61 24 W 40S RIBOSOMAL PROTEIN S15A 9986
217 4D5L 24 W 40S RIBOSOMAL PROTEIN US8 9986
218 4V3P 27 SH Ribosomal protein S15 4565
219 3J81 24 W uS8 28985
220 3J80 14 W uS8 28985
221 3J7P 72 SW Ribosomal protein uS8 9823
222 3J7R 73 SW Ribosomal protein uS8 9823
223 4UJC 73 CW 40S RIBOSOMAL PROTEIN US8 9986
224 4UJD 73 CW 40S RIBOSOMAL PROTEIN US8 9986
225 3J7A 11 K 40S ribosomal protein uS8 5833
226 3J77 68 22 40S ribosomal protein S22 4932
227 3J78 68 22 40S ribosomal protein S22 4932
228 3J6X 69 22 40S ribosomal protein S22 4932
229 3J6Y 69 22 40S ribosomal protein S22 4932
230 4UJE 27 BW 40S RIBOSOMAL PROTEIN S15A 9986
231 4V92 25 BW US8 28985
232 4V7E 24 BW 40S ribosomal protein S8 4565
233 4V8Y 31 AW 40S RIBOSOMAL PROTEIN S22-A 4932
234 4V8Z 31 AW 40S RIBOSOMAL PROTEIN S22-A 4932
235 4V4N 21 BI 30S ribosomal protein S8P SEE REMARK 999 2190
236 4V6W 32 AW 40S ribosomal protein S15Aa 7227
237 4V6X 32 AW 40S ribosomal protein S15a 9606
238 4V8M 18 AJ 40S RIBOSOMAL PROTEIN S15A, PUTATIVE 185431
239 4V6U 3 AI 30S ribosomal protein S8P 2261
240 4V6I 9 AH 40S ribosomal protein rpS22 (S8p) 4932
241 4V7H 7 AH 40S ribosomal protein S22(A) 5541
242 4V5Z 15 Ah 40S Ribosomal protein S15ae 9612
243 4V4B 8 AH 40S ribosomal protein S22 4932