6RXV

Cryo-EM structure of the 90S pre-ribosome (Kre33-Noc4) from Chaetomium thermophilum, state B2


Sequence Similarity Clusters for the Entities in PDB 6RXV

Entity #1 | Chains: UA
Periodic tryptophan protein 2-like protein protein, length: 904 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 12509
95 % 3 7 12530
90 % 3 7 12364
70 % 3 7 11735
50 % 3 11 7099
40 % 3 11 6855
30 % 3 11 6426
Entity #10 | Chains: UM
Utp13 protein, length: 912 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13066
95 % 3 7 12499
90 % 3 7 12335
70 % 3 7 11713
50 % 3 7 10689
40 % 3 7 10077
30 % 3 7 9315
Entity #11 | Chains: UN
Utp14 protein, length: 938 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 12664
95 % 3 7 12816
90 % 3 7 12646
70 % 3 7 11988
50 % 3 7 11288
40 % 3 7 10316
30 % 3 7 9810
Entity #12 | Chains: UO
Utp15 protein, length: 557 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 12665
95 % 3 7 12817
90 % 3 7 12647
70 % 3 7 11989
50 % 3 7 10973
40 % 3 7 10317
30 % 3 9 7806
Entity #13 | Chains: UQ
Utp17 protein, length: 960 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 12514
95 % 3 7 13335
90 % 3 7 12369
70 % 3 7 11564
50 % 3 7 10560
40 % 3 7 9957
30 % 3 7 9206
Entity #14 | Chains: UR
Utp18 protein, length: 618 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 12425
95 % 3 7 12347
90 % 3 7 12181
70 % 3 7 11585
50 % 3 7 10576
40 % 3 7 9970
30 % 3 11 6568
Entity #15 | Chains: UU
Utp21 protein, length: 1049 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 12826
95 % 3 7 13091
90 % 3 7 12921
70 % 3 7 12242
50 % 3 7 11199
40 % 3 7 10552
30 % 3 7 9738
Entity #16 | Chains: UX
Utp24 protein, length: 193 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 8 10997
95 % 3 8 11387
90 % 3 8 11232
70 % 3 8 10770
50 % 3 12 6976
40 % 3 12 6744
30 % 3 12 6338
Entity #17 | Chains: UZ
Utp30 protein, length: 391 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 12666
95 % 3 7 13155
90 % 3 7 13017
70 % 3 7 12461
50 % 3 7 11230
40 % 3 7 10624
30 % 3 7 9528
Entity #18 | Chains: CA,CB
Nop1 protein, length: 313 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 4970
95 % 3 7 5924
90 % 3 7 5945
70 % 3 7 6010
50 % 3 11 3588
40 % 3 11 3572
30 % 3 11 3491
Entity #19 | Chains: CC
Nop56 protein, length: 523 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13065
95 % 3 7 12498
90 % 3 7 12334
70 % 3 7 11712
50 % 3 11 7133
40 % 3 15 5086
30 % 3 15 5014
Entity #2 | Chains: UB
Utp2 protein, length: 907 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13010
95 % 3 7 12393
90 % 3 7 12687
70 % 3 7 11625
50 % 3 7 10611
40 % 3 7 10347
30 % 3 7 9246
Entity #20 | Chains: CD
Nop58 protein, length: 582 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 12620
95 % 3 7 12721
90 % 3 7 12551
70 % 3 7 12477
50 % 3 7 10879
40 % 3 7 10747
30 % 3 7 9915
Entity #21 | Chains: CE,CF
Snu13 protein, length: 127 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 4915
95 % 3 7 5803
90 % 3 7 5911
70 % 3 7 5835
50 % 12 34 1328
40 % 13 35 1313
30 % 12 34 1401
Entity #22 | Chains: CG
Rrp9 protein, length: 630 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13461
95 % 3 7 13260
90 % 3 7 13086
70 % 3 7 12413
50 % 3 7 11357
40 % 3 7 10691
30 % 3 7 9865
Entity #23 | Chains: CH
RNA 3'-terminal phosphate cyclase-like protein protein, length: 411 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 12877
95 % 3 7 13187
90 % 3 7 13011
70 % 3 7 12326
50 % 3 7 11281
40 % 3 7 10621
30 % 3 7 9805
Entity #24 | Chains: CI
Bms1 protein, length: 1163 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 12621
95 % 3 7 12722
90 % 3 7 12552
70 % 3 7 11899
50 % 3 7 10880
40 % 3 11 7118
30 % 3 11 6685
Entity #25 | Chains: CJ
Imp3 protein, length: 183 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 8 10195
95 % 3 8 11130
90 % 3 8 10977
70 % 3 8 10533
50 % 3 12 6579
40 % 3 12 6385
30 % 3 12 6028
Entity #26 | Chains: CK
Imp4 protein, length: 297 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 8 11066
95 % 3 8 11940
90 % 3 8 11790
70 % 3 8 11234
50 % 3 11 7372
40 % 3 11 7114
30 % 3 11 6681
Entity #27 | Chains: CL
Mpp10 protein, length: 785 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 12622
95 % 3 7 12723
90 % 3 7 12553
70 % 3 7 11900
50 % 3 7 10881
40 % 3 7 10235
30 % 3 7 9460
Entity #28 | Chains: CM
Sof1 protein, length: 446 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13460
95 % 3 7 12877
90 % 3 7 13145
70 % 3 7 12040
50 % 3 7 11413
40 % 3 9 8273
30 % 3 9 7950
Entity #29 | Chains: CN,CO
Emg1 protein, length: 252 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 5378
95 % 3 7 5867
90 % 3 7 5852
70 % 8 17 2293
50 % 8 17 2339
40 % 8 17 2404
30 % 8 17 2383
Entity #3 | Chains: UC
Utp3 protein, length: 648 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13011
95 % 3 7 12395
90 % 3 7 12222
70 % 3 7 11628
50 % 3 7 10612
40 % 3 7 10009
30 % 3 7 9249
Entity #30 | Chains: CP
KRR1 small subunit processome component protein, length: 322 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 8 9190
95 % 3 8 9887
90 % 3 8 9364
70 % 3 11 7404
50 % 3 11 6453
40 % 3 11 6261
30 % 3 11 5922
Entity #31 | Chains: CQ
Pre-rRNA-processing protein PNO1 protein, length: 259 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 12667
95 % 3 7 12819
90 % 3 7 12649
70 % 3 7 11990
50 % 3 7 10974
40 % 3 7 10318
30 % 3 7 9529
Entity #32 | Chains: CR,CS
Kre33 protein, length: 1073 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 8 4331
95 % 3 8 4967
90 % 3 8 5038
70 % 3 8 5057
50 % 3 8 4962
40 % 3 8 4922
30 % 3 8 4731
Entity #33 | Chains: CT
Fcf2 protein, length: 203 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13124
95 % 3 7 12550
90 % 3 7 12382
70 % 3 7 11751
50 % 3 7 10732
40 % 3 7 10106
30 % 3 7 9341
Entity #34 | Chains: Ca
40S ribosomal protein S1 protein, length: 255 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 5 18787
95 % 3 5 18396
90 % 3 5 18029
70 % 41 81 490
50 % 46 137 360
40 % 48 144 352
30 % 48 144 370
Entity #35 | Chains: Cb
40S ribosomal protein S4 protein, length: 264 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 5 19532
95 % 2 5 18028
90 % 2 5 17319
70 % 45 163 264
50 % 47 173 264
40 % 47 177 271
30 % 47 182 277
Entity #36 | Chains: Cc
40S ribosomal protein s5-like protein protein, length: 212 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 12400
95 % 3 7 12294
90 % 3 7 12123
70 % 8 93 633
50 % 49 183 235
40 % 49 183 245
30 % 49 183 263
Entity #37 | Chains: Cd
40S ribosomal protein S6 protein, length: 239 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 5 18147
95 % 2 5 16685
90 % 2 5 17017
70 % 7 83 702
50 % 46 164 309
40 % 46 169 309
30 % 46 169 333
Entity #38 | Chains: Ce
40S ribosomal protein S7 protein, length: 203 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 12416
95 % 3 7 12332
90 % 3 7 12124
70 % 3 7 11565
50 % 46 170 287
40 % 46 170 303
30 % 48 173 305
Entity #39 | Chains: Cf
40S ribosomal protein S8 protein, length: 202 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 5 20037
95 % 2 5 18494
90 % 2 5 18121
70 % 40 83 477
50 % 47 172 267
40 % 47 176 274
30 % 47 176 298
Entity #4 | Chains: UD
Utp4 protein, length: 884 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 4 8 9289
95 % 4 8 9669
90 % 4 8 9836
70 % 4 8 9269
50 % 4 8 8630
40 % 4 8 8310
30 % 4 8 7727
Entity #40 | Chains: Cg
40S ribosomal protein s9-like protein protein, length: 190 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 12559
95 % 3 7 12619
90 % 3 7 12448
70 % 47 167 258
50 % 49 182 236
40 % 49 186 242
30 % 49 186 256
Entity #41 | Chains: Ch
40S ribosomal protein S13-like protein protein, length: 151 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13159
95 % 3 7 12705
90 % 3 7 12538
70 % 47 172 250
50 % 49 179 246
40 % 49 184 244
30 % 49 184 259
Entity #42 | Chains: Ci
40S ribosomal protein S14-like protein protein, length: 150 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 12760
95 % 3 7 12965
90 % 7 73 792
70 % 49 180 231
50 % 49 181 240
40 % 49 181 252
30 % 49 181 276
Entity #43 | Chains: Cj
40S ribosomal protein S16-like protein protein, length: 143 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13202
95 % 3 7 12790
90 % 3 7 12618
70 % 3 7 11961
50 % 49 174 260
40 % 49 178 262
30 % 49 179 281
Entity #44 | Chains: Ck
40S ribosomal protein S11-like protein protein, length: 161 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 5 19637
95 % 2 5 17805
90 % 2 5 17493
70 % 41 85 466
50 % 48 179 244
40 % 48 179 256
30 % 48 179 280
Entity #45 | Chains: Cm
40S ribosomal protein S22-like protein protein, length: 130 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13341
95 % 3 7 12618
90 % 3 7 12581
70 % 48 183 236
50 % 50 185 231
40 % 51 190 238
30 % 406 744 23
Entity #46 | Chains: Cn
40S ribosomal protein s23-like protein protein, length: 145 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13160
95 % 3 7 12522
90 % 3 7 12359
70 % 49 186 213
50 % 49 192 227
40 % 49 192 236
30 % 49 192 248
Entity #47 | Chains: Co
40S ribosomal protein S24 protein, length: 136 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 5 19757
95 % 2 5 17806
90 % 2 5 17701
70 % 40 85 474
50 % 45 174 273
40 % 45 174 288
30 % 45 174 311
Entity #48 | Chains: Cp
40S ribosomal protein S28-like protein protein, length: 68 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 12761
95 % 3 7 13079
90 % 3 7 12798
70 % 47 173 249
50 % 49 180 242
40 % 49 181 250
30 % 49 181 271
Entity #49 | Chains: CU
Faf1 protein, length: 311 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13438
95 % 3 7 13236
90 % 3 7 13061
70 % 3 7 12386
50 % 3 7 11330
40 % 3 7 10663
30 % 3 7 9842
Entity #5 | Chains: UF
Utp6 protein, length: 414 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 12882
95 % 3 7 13195
90 % 3 7 13018
70 % 3 7 12334
50 % 3 7 11289
40 % 3 7 10625
30 % 3 7 9811
Entity #50 | Chains: C1
35S ribosomal RNA rna, length: 2352 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
Entity #51 | Chains: C2
U3 snoRNA rna, length: 230 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
Entity #52 | Chains: UV
U3 small nucleolar RNA-associated protein 22 protein, length: 1171 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 4 29767
95 % 1 4 25038
90 % 1 4 24264
70 % 1 4 22158
50 % 1 4 19540
40 % 1 4 17906
30 % 1 4 16080
Entity #53 | Chains: CV
Rrp7 protein, length: 322 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 4 25190
95 % 1 4 25651
90 % 1 4 24813
70 % 1 4 22643
50 % 1 4 19932
40 % 1 4 18252
30 % 1 4 16374
Entity #54 | Chains: CW
Ribosome biogenesis protein ENP2 protein, length: 668 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 4 26538
95 % 2 4 20538
90 % 2 4 22208
70 % 2 4 20365
50 % 2 4 16524
40 % 2 4 16587
30 % 2 4 13869
Entity #55 | Chains: UT
Utp20 protein, length: 2612 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 4 26539
95 % 2 4 24630
90 % 2 4 20080
70 % 2 4 20366
50 % 2 4 16525
40 % 2 4 16588
30 % 2 4 14135
Entity #56 | Chains: UH
Utp8 protein, length: 930 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 6 16049
95 % 3 6 13931
90 % 3 6 15048
70 % 3 6 12992
50 % 3 6 11633
40 % 3 6 11989
30 % 3 6 10072
Entity #57 | Chains: UE,UI
Utp5 protein, length: 410 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 6 7023
95 % 3 6 7622
90 % 3 6 7599
70 % 3 6 7457
50 % 3 6 7018
40 % 3 6 6783
30 % 3 6 6366
Entity #58 | Chains: US
Noc4 protein, length: 549 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 6 17658
95 % 3 6 16509
90 % 3 6 16218
70 % 3 6 15162
50 % 3 6 13703
40 % 3 6 12761
30 % 3 6 11660
Entity #59 | Chains: Cl
Rps18 protein, length: 156 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 6 16788
95 % 3 6 15163
90 % 3 6 14903
70 % 47 165 260
50 % 49 174 258
40 % 49 180 254
30 % 49 180 278
Entity #6 | Chains: UG
Utp7 protein, length: 558 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13012
95 % 3 7 12396
90 % 3 7 12223
70 % 3 7 11629
50 % 3 7 10613
40 % 3 9 8136
30 % 3 9 7606
Entity #60 | Chains: CX
Enp1 protein, length: 480 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 6 16748
95 % 3 6 15100
90 % 3 6 14833
70 % 3 6 13970
50 % 3 6 12680
40 % 3 6 11863
30 % 3 14 5147
Entity #61 | Chains: CY
U3 small nucleolar ribonucleoprotein protein lcp5-like protein protein, length: 381 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 3 34332
95 % 2 3 26980
90 % 2 3 26027
70 % 2 3 23719
50 % 2 3 20821
40 % 2 3 19073
30 % 2 3 17101
Entity #62 | Chains: CZ
Bfr2 protein, length: 609 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 4 28157
95 % 2 4 22854
90 % 2 4 22216
70 % 2 4 20374
50 % 2 4 18053
40 % 2 4 16598
30 % 2 4 14974
Entity #63 | Chains: UP
Utp16 protein, length: 364 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 6 16787
95 % 3 6 15162
90 % 3 6 14902
70 % 3 6 14033
50 % 3 6 12720
40 % 3 6 11895
30 % 3 6 10903
Entity #7 | Chains: UJ
UTP10 protein, length: 1802 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 8 12274
95 % 3 8 12106
90 % 3 8 11942
70 % 3 8 11376
50 % 3 8 10404
40 % 3 8 9814
30 % 3 8 9093
Entity #8 | Chains: UK
U3 small nucleolar RNA-associated protein 11 protein, length: 270 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 12883
95 % 3 7 13196
90 % 3 7 13019
70 % 3 7 12335
50 % 3 7 11290
40 % 3 7 10626
30 % 3 7 9812
Entity #9 | Chains: UL
Utp12 protein, length: 962 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13456
95 % 3 7 13254
90 % 3 7 13080
70 % 3 7 12407
50 % 3 7 11352
40 % 3 11 6910
30 % 3 11 6479

Instructions

In the table for each entity, view a list of similar sequences by selecting the link associated with the percentage cutoff.



View more detailed documentation on the redundancy reduction and sequence clustering procedure used by RCSB PDB.

You can also use the structure comparison tool to compare any 2 given structures


ACTION - (A) Select for download / view details OR (B) Select two chains for comparison
Rank PDB ID Entity ID Chains Description Details Taxonomy EC Number
1 1I6U 2 A, B 30S RIBOSOMAL PROTEIN S8P 2190
2 4V88 24 AW, CW 40S ribosomal protein S22-A 4932
3 4U4R 24 D2, d2 40S ribosomal protein S22-A 4932
4 4U3U 24 D2, d2 40S ribosomal protein S22-A 4932
5 5TBW 71 X, d2 40S ribosomal protein S22-A 4932
6 4U3M 24 D2, d2 40S ribosomal protein S22-A 4932
7 4U3N 24 D2, d2 40S ribosomal protein S22-A 4932
8 4U52 24 D2, d2 40S ribosomal protein S22-A 4932
9 4U4Q 24 D2, d2 40S ribosomal protein S22-A 4932
10 4U6F 24 D2, d2 40S ribosomal protein S22-A 4932
11 4U4U 24 D2, d2 40S ribosomal protein S22-A 4932
12 4U4Z 24 D2, d2 40S ribosomal protein S22-A 4932
13 4U4Y 24 D2, d2 40S ribosomal protein S22-A 4932
14 4U4N 24 D2, d2 40S ribosomal protein S22-A 4932
15 4U55 24 D2, d2 40S ribosomal protein S22-A 4932
16 5DAT 24 D2 40S ribosomal protein S22-A 4932
17 5DAT 80 d2 40S ribosomal protein S22-A 4932
18 5I4L 24 D2, d2 40S ribosomal protein S22-A 4932
19 4U51 24 D2, d2 40S ribosomal protein S22-A 4932
20 6HHQ 70 X, d2 40S ribosomal protein S22-A 4932
21 5OBM 68 D2, d2 40S ribosomal protein S22-A 4932
22 4U53 24 D2, d2 40S ribosomal protein S22-A 4932
23 5ON6 72 X, d2 40S ribosomal protein S22-A 4932
24 4U50 24 D2, d2 40S ribosomal protein S22-A 4932
25 5NDV 68 D2, d2 40S ribosomal protein S22-A 4932
26 5LYB 24 D2, d2 40S ribosomal protein S22-A 4932
27 4U56 24 D2, d2 40S ribosomal protein S22-A 4932
28 5TGA 24 D2, d2 40S ribosomal protein S22-A 4932
29 5MEI 71 X, d2 40S ribosomal protein S22-A 4932
30 5FCJ 24 D2, d2 40S ribosomal protein S22-A 4932
31 4U4O 24 D2, d2 40S ribosomal protein S22-A 4932
32 5DGV 24 D2, d2 40S ribosomal protein S22-A 4932
33 5DGE 24 D2, d2 40S ribosomal protein S22-A 4932
34 5NDW 17 D2, d2 40S ribosomal protein S22-A 4932
35 4BTS 18 AH, BH, CH, DH 40S RIBOSOMAL PROTEIN RPS22E 5911
36 5NDG 24 D2, d2 40S ribosomal protein S22-A 4932
37 5FCI 24 D2, d2 40S ribosomal protein S22-A 4932
38 5DC3 24 D2, d2 40S ribosomal protein S22-A 4932
39 5DGF 24 D2, d2 40S ribosomal protein S22-A 4932
40 4V5O 17 AH, BH RIBOSOMAL PROTEIN S8 CONTAINING PROTEIN 5911
41 5TGM 24 D2, d2 40S ribosomal protein S22-A 4932
42 4V7R 16 AO, CO 40S ribosomal protein S22-A 4932
43 5VYC 16 W1, W2, W3, W4, W5, W6 40S ribosomal protein S15a 9606
44 4KZZ 23 W 40S Ribosomal Protein S15A 9986
45 4KZX 23 W 40S ribosomal protein S15A 9986
46 4KZY 23 W 40S Ribosomal Protein S15A 9986
47 6SGC 24 X1 Ribosomal protein S15a 9986
48 6S47 68 BX 40S ribosomal protein S22-A TRSSVLADALNAINNAEKTGKRQVLIRPSSKVIIKFLQVMQKHGYIGEFEYIDDHRSGK IVVQLNGRLNKCGVISPRFNVKIGDIEKWTANLLPARQFGYVILTTSAGIMDHEEARRKH VSGKILGFVY 4932
49 6RXT 41 Cm 40S ribosomal protein S22-like protein 209285
50 6RXU 45 Cm 40S ribosomal protein S22-like protein 209285
51 6RXV 45 Cm 40S ribosomal protein S22-like protein 209285
52 6RXX 26 Cm 40S ribosomal protein S22-like protein 209285
53 6RXY 40 Cm 40S ribosomal protein S22-like protein 209285
54 6RXZ 44 Cm 40S ribosomal protein S22-like protein 209285
55 6P5I 24 X uS8 9986
56 6P5J 24 X uS8 9986
57 6P5K 70 X uS8 9986
58 6P5N 70 X uS8 9986
59 6P4G 24 X uS8 9986
60 6P4H 25 X uS8 9986
61 6OM7 29 SW 40S ribosomal protein S15a 9606
62 6OLZ 69 BW 40S ribosomal protein S15a 9606
63 6OM0 29 SW 40S ribosomal protein S15a 9606
64 6OLE 29 SW 40S ribosomal protein S15a 9606
65 6OLF 29 SW 40S ribosomal protein S15a 9606
66 6OLG 72 BW 40S ribosomal protein S15a 9606
67 6OLI 29 SW 40S ribosomal protein S15a 9606
68 6OKK 11 K 40S ribosomal protein S15A 5833
69 6RBD 15 W 40S ribosomal protein S22-A 4932
70 6RBE 15 W 40S ribosomal protein S22-A 4932
71 6R7Q 82 TT Ribosomal protein S15a 9986
72 6R6G 50 TT Ribosomal protein S15a 9986
73 6R6P 66 TT Ribosomal protein S15a 9986
74 6R5Q 74 TT Ribosomal protein S15a 9986
75 6QZP 76 SW 40S ribosomal protein S15a 9606
76 6Q8Y 27 b 40S ribosomal protein S22-A 4932
77 6I7O 41 b, bb 40S ribosomal protein S22-A 4932
78 6IP5 75 3M 40S ribosomal protein S15a 9606
79 6IP6 74 3M 40S ribosomal protein S15a 9606
80 6IP8 74 3M 40S ribosomal protein S15a 9606
81 6MTB 73 WW 40S ribosomal protein S15a 9986
82 6MTC 72 WW 40S ribosomal protein S15a 9986
83 6MTD 74 WW uS8 9986
84 6MTE 73 WW uS8 9986
85 6HCQ 27 X2 Ribosomal protein S15a 9986
86 6HCJ 27 X2 Ribosomal protein S15a 9986
87 6HCM 24 X1 Ribosomal protein S15a 9986
88 6HCF 24 X1 Ribosomal protein S15a 9986
89 6GZ3 33 BW Ribosomal protein S15a 9986
90 6GZ4 36 BW ribosomal protein uS8 9986
91 6GZ5 33 BW ribosomal protein uS8 9986
92 6GSM 26 W 40S ribosomal protein S22 28985
93 6GSN 40 W 40S ribosomal protein S22 28985
94 6GQV 70 AM 40S ribosomal protein S22-A 4932
95 6GQ1 70 AM 40S ribosomal protein S22-A 4932
96 6GQB 70 AM 40S ribosomal protein S22-A 4932
97 6D9J 72 XX uS8 9986
98 6D90 73 XX uS8 9986
99 6G5H 14 W 40S ribosomal protein S15a 9606
100 6G5I 24 W 40S ribosomal protein S15a 9606
101 6G4S 19 W 40S ribosomal protein S15a 9606
102 6G4W 16 W 40S ribosomal protein S15a 9606
103 6G51 15 W 40S ribosomal protein S15a 9606
104 6G53 15 W 40S ribosomal protein S15a 9606
105 6G18 25 W 40S ribosomal protein S15a 9606
106 6FYX 26 W 40S ribosomal protein S22 28985
107 6FYY 26 W 40S ribosomal protein S22 28985
108 6FEC 29 a 40S ribosomal protein S15a 9606
109 6FAI 33 W 40S ribosomal protein S22-A 4932
110 6EML 24 b 40S ribosomal protein S22-A 4932
111 6EK0 76 SW 40S ribosomal protein S15a 9606
112 6AZ1 10 J ribosomal protein S8 5661
113 5OQL 45 w 40S ribosomal protein S22-like protein 209285
114 5OPT 22 e 40S ribosomal protein S15a, putative 5693
115 5WLC 13 LE rpS22_uS8 4932
116 5XYI 24 W Ribosomal protein S15a 5722
117 5XXU 24 W Ribosomal protein uS8 5811
118 5OA3 27 W 40S ribosomal protein S15a 9606
119 5WYJ 47 SX 40S ribosomal protein S22-A 4932
120 5WYK 43 SX 40S ribosomal protein S22-A 4932
121 5TZS 14 E rpS22_uS8 4932
122 5MC6 29 b 40S ribosomal protein S22-A 4932
123 5M1J 30 W2 40S ribosomal protein S22-A 4932
124 5LZS 73 WW uS8 9986
125 5LZT 74 WW uS8 9986
126 5LZU 73 WW uS8 9986
127 5LZV 74 WW uS8 9986
128 5LZW 74 WW uS8 9986
129 5LZX 74 WW uS8 9986
130 5LZY 72 WW uS8 9986
131 5LZZ 74 WW uS8 9986
132 5T2A 65 AJ uS8 5661
133 5T2C 57 AP 40S ribosomal protein S15a 9606
134 5LL6 14 b 40S ribosomal protein S22-A 4932
135 5LKS 75 SW 40S ribosomal protein S15a 9606
136 5K0Y 23 a ribosomal protein uS8 9986
137 5JUO 72 TB uS8 (yeast S22) 4932
138 5JUP 72 TB uS8 (yeast S22) 4932
139 5JUS 72 TB uS8 (yeast S22) 4932
140 5JUT 72 TB uS8 (yeast S22) 4932
141 5JUU 72 TB uS8 (yeast S22) 4932
142 5JPQ 32 z uS8 209285
143 5JB3 15 I 30S ribosomal protein S8 30S ribosomal protein uS8 model from Pyrococcus furiosus (PDB code 4V6U) used for fitting 29292
144 5JBH 26 I 30S ribosomal protein uS8 30S ribosomal protein uS8 model from Pyrococcus furiosus (PDB code 4V6U) used for fitting 29292
145 5IT7 70 W 40S ribosomal protein S22 28985
146 5IT9 23 W Ribosomal protein uS8 28985
147 5FLX 24 W 40S RIBOSOMAL PROTEIN S15A 9986
148 3JBN 7 K 40S ribosomal protein uS8 5833
149 3JBO 29 K 40S ribosomal protein uS8 5833
150 3JBP 7 K 40S ribosomal protein uS8 5833
151 3JAP 26 W uS8 28985
152 3JAQ 26 W uS8 28985
153 3JAM 24 W uS8 28985
154 3JAN 66 SW Ribosomal protein uS8 SEE REMARK 999 9986
155 3JAJ 67 SW Ribosomal protein uS8 SEE REMARK 999 9986
156 3JAG 74 WW uS8 9986
157 3JAH 74 WW uS8 9986
158 3JAI 74 WW uS8 9986
159 5A2Q 25 W RIBOSOMAL PROTEIN US8 9606
160 4UG0 77 SW 40S RIBOSOMAL PROTEIN S15A 9606
161 5AJ0 72 BW 40S ribosomal protein S15a 9606
162 4UER 18 H US8 4934
163 4D61 24 W 40S RIBOSOMAL PROTEIN S15A 9986
164 4D5L 24 W 40S RIBOSOMAL PROTEIN US8 9986
165 4V3P 27 SH Ribosomal protein S15 4565
166 3J81 24 W uS8 28985
167 3J80 14 W uS8 28985
168 3J7P 72 SW Ribosomal protein uS8 9823
169 3J7R 73 SW Ribosomal protein uS8 9823
170 4UJC 73 CW 40S RIBOSOMAL PROTEIN US8 9986
171 4UJD 73 CW 40S RIBOSOMAL PROTEIN US8 9986
172 3J7A 11 K 40S ribosomal protein uS8 5833
173 3J77 68 22 40S ribosomal protein S22 4932
174 3J78 68 22 40S ribosomal protein S22 4932
175 3J6X 69 22 40S ribosomal protein S22 4932
176 3J6Y 69 22 40S ribosomal protein S22 4932
177 4UJE 27 BW 40S RIBOSOMAL PROTEIN S15A 9986
178 4V92 25 BW US8 28985
179 4V7E 24 BW 40S ribosomal protein S8 4565
180 4V8Y 31 AW 40S RIBOSOMAL PROTEIN S22-A 4932
181 4V8Z 31 AW 40S RIBOSOMAL PROTEIN S22-A 4932
182 4V4N 21 BI 30S ribosomal protein S8P SEE REMARK 999 2190
183 4V6W 32 AW 40S ribosomal protein S15Aa 7227
184 4V6X 32 AW 40S ribosomal protein S15a 9606
185 4V8M 18 AJ 40S RIBOSOMAL PROTEIN S15A, PUTATIVE 185431
186 4V6U 3 AI 30S ribosomal protein S8P 2261
187 4V6I 9 AH 40S ribosomal protein rpS22 (S8p) 4932
188 4V7H 7 AH 40S ribosomal protein S22(A) 5541
189 4V5Z 15 Ah 40S Ribosomal protein S15ae 9612
190 4V4B 8 AH 40S ribosomal protein S22 4932