6RXV

Cryo-EM structure of the 90S pre-ribosome (Kre33-Noc4) from Chaetomium thermophilum, state B2


Sequence Similarity Clusters for the Entities in PDB 6RXV

Entity #1 | Chains: UA
Periodic tryptophan protein 2-like protein protein, length: 904 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13440
95 % 3 7 13263
90 % 3 7 13078
70 % 3 7 12428
50 % 3 11 7367
40 % 3 11 7117
30 % 3 11 6681
Entity #10 | Chains: UM
Utp13 protein, length: 912 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 12779
95 % 3 7 13038
90 % 3 7 12852
70 % 3 7 12212
50 % 3 7 11162
40 % 3 7 10515
30 % 3 7 9725
Entity #11 | Chains: UN
Utp14 protein, length: 938 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13143
95 % 3 7 12337
90 % 3 7 12384
70 % 3 7 11787
50 % 3 7 10760
40 % 3 7 10133
30 % 3 7 9213
Entity #12 | Chains: UO
Utp15 protein, length: 557 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 12780
95 % 3 7 13039
90 % 3 7 12853
70 % 3 7 12213
50 % 3 7 11163
40 % 3 7 10516
30 % 3 9 7685
Entity #13 | Chains: UQ
Utp17 protein, length: 960 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 12489
95 % 3 7 12301
90 % 3 7 13119
70 % 3 7 11537
50 % 3 7 10535
40 % 3 7 9924
30 % 3 7 9197
Entity #14 | Chains: UR
Utp18 protein, length: 618 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 12995
95 % 3 7 12438
90 % 3 7 12270
70 % 3 7 11685
50 % 3 7 10666
40 % 3 7 10044
30 % 3 11 6468
Entity #15 | Chains: UU
Utp21 protein, length: 1049 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 12925
95 % 3 7 12300
90 % 3 7 12117
70 % 3 7 11536
50 % 3 7 10534
40 % 3 7 9923
30 % 3 7 9196
Entity #16 | Chains: UX
Utp24 protein, length: 193 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 8 11993
95 % 3 8 10562
90 % 3 8 11189
70 % 3 8 10816
50 % 3 12 6772
40 % 3 12 6082
30 % 3 12 6002
Entity #17 | Chains: UZ
Utp30 protein, length: 391 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 12395
95 % 3 7 12315
90 % 3 7 12133
70 % 3 7 11559
50 % 3 7 10553
40 % 3 7 9941
30 % 3 7 9214
Entity #18 | Chains: CA,CB
Nop1 protein, length: 313 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 5352
95 % 3 7 6145
90 % 3 7 6171
70 % 3 7 6092
50 % 3 11 3459
40 % 3 11 3447
30 % 3 11 3375
Entity #19 | Chains: CC
Nop56 protein, length: 523 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13231
95 % 3 7 12876
90 % 3 7 12709
70 % 3 7 12079
50 % 3 11 7370
40 % 3 15 5279
30 % 3 15 5054
Entity #2 | Chains: UB
Utp2 protein, length: 907 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 12947
95 % 3 7 12786
90 % 3 7 12172
70 % 3 7 11600
50 % 3 7 10588
40 % 3 7 9969
30 % 3 7 9238
Entity #20 | Chains: CD
Nop58 protein, length: 582 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 12755
95 % 3 7 12533
90 % 3 7 13009
70 % 3 7 11772
50 % 3 7 11125
40 % 3 7 10488
30 % 3 7 9697
Entity #21 | Chains: CE,CF
Snu13 protein, length: 127 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 5351
95 % 3 7 6144
90 % 3 7 6170
70 % 3 7 6091
50 % 12 34 1326
40 % 13 35 1306
30 % 12 34 1398
Entity #22 | Chains: CG
Rrp9 protein, length: 630 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13419
95 % 3 7 13230
90 % 3 7 13046
70 % 3 7 12397
50 % 3 7 11332
40 % 3 7 10664
30 % 3 7 9861
Entity #23 | Chains: CH
RNA 3'-terminal phosphate cyclase-like protein protein, length: 411 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13273
95 % 3 7 12953
90 % 3 7 12780
70 % 3 7 12137
50 % 3 7 11094
40 % 3 7 10460
30 % 3 7 9671
Entity #24 | Chains: CI
Bms1 protein, length: 1163 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 12756
95 % 3 7 12997
90 % 3 7 12810
70 % 3 7 12173
50 % 3 7 11126
40 % 3 11 7111
30 % 3 11 6675
Entity #25 | Chains: CJ
Imp3 protein, length: 183 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 8 10166
95 % 3 8 11078
90 % 3 8 10914
70 % 3 8 10566
50 % 3 12 6582
40 % 3 12 6373
30 % 3 12 6040
Entity #26 | Chains: CK
Imp4 protein, length: 297 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 8 10028
95 % 3 8 10843
90 % 3 8 10701
70 % 3 8 10352
50 % 3 11 7357
40 % 3 11 7107
30 % 3 11 6673
Entity #27 | Chains: CL
Mpp10 protein, length: 785 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 12405
95 % 3 7 12952
90 % 3 7 12284
70 % 3 7 11539
50 % 3 7 11093
40 % 3 7 10459
30 % 3 7 9670
Entity #28 | Chains: CM
Sof1 protein, length: 446 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13274
95 % 3 7 12331
90 % 3 7 12781
70 % 3 7 11577
50 % 3 7 11095
40 % 3 9 7972
30 % 3 9 7456
Entity #29 | Chains: CN,CO
Emg1 protein, length: 252 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 5105
95 % 3 7 6096
90 % 3 7 5738
70 % 8 17 2249
50 % 8 17 2337
40 % 8 17 2367
30 % 8 17 2358
Entity #3 | Chains: UC
Utp3 protein, length: 648 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13414
95 % 3 7 13222
90 % 3 7 13040
70 % 3 7 12389
50 % 3 7 11323
40 % 3 7 10655
30 % 3 7 9855
Entity #30 | Chains: CP
KRR1 small subunit processome component protein, length: 322 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 8 9176
95 % 3 8 9365
90 % 3 8 9699
70 % 3 11 7395
50 % 3 11 6809
40 % 3 11 6586
30 % 3 11 5868
Entity #31 | Chains: CQ
Pre-rRNA-processing protein PNO1 protein, length: 259 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13068
95 % 3 7 12587
90 % 3 7 12411
70 % 3 7 11814
50 % 3 7 11245
40 % 3 7 10588
30 % 3 7 9790
Entity #32 | Chains: CR,CS
Kre33 protein, length: 1073 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 8 4334
95 % 3 8 4972
90 % 3 8 5197
70 % 3 8 4980
50 % 3 8 5043
40 % 3 8 4918
30 % 3 8 4742
Entity #33 | Chains: CT
Fcf2 protein, length: 203 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 12820
95 % 3 7 13142
90 % 3 7 12958
70 % 3 7 12316
50 % 3 7 11254
40 % 3 7 10596
30 % 3 7 9798
Entity #34 | Chains: Ca
40S ribosomal protein S1 protein, length: 255 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 5 17717
95 % 3 5 16618
90 % 3 5 16325
70 % 41 81 488
50 % 46 137 360
40 % 48 144 349
30 % 48 144 365
Entity #35 | Chains: Cb
40S ribosomal protein S4 protein, length: 264 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 5 18120
95 % 2 5 17272
90 % 2 5 16943
70 % 45 163 264
50 % 47 173 263
40 % 47 177 266
30 % 47 182 270
Entity #36 | Chains: Cc
40S ribosomal protein s5-like protein protein, length: 212 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13406
95 % 3 7 13215
90 % 3 7 13034
70 % 8 93 624
50 % 49 183 230
40 % 49 183 243
30 % 49 183 258
Entity #37 | Chains: Cd
40S ribosomal protein S6 protein, length: 239 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 5 17751
95 % 2 5 16617
90 % 2 5 16324
70 % 7 83 707
50 % 46 164 305
40 % 46 169 303
30 % 46 169 323
Entity #38 | Chains: Ce
40S ribosomal protein S7 protein, length: 203 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13408
95 % 3 7 13217
90 % 3 7 13035
70 % 3 7 12382
50 % 46 170 287
40 % 46 170 297
30 % 48 173 299
Entity #39 | Chains: Cf
40S ribosomal protein S8 protein, length: 202 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 5 18119
95 % 2 5 17270
90 % 2 5 16942
70 % 40 83 475
50 % 47 172 267
40 % 47 176 268
30 % 47 176 286
Entity #4 | Chains: UD
Utp4 protein, length: 884 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 4 8 8833
95 % 4 8 9606
90 % 4 8 9184
70 % 4 8 8925
50 % 4 8 8289
40 % 4 8 7982
30 % 4 8 7469
Entity #40 | Chains: Cg
40S ribosomal protein s9-like protein protein, length: 190 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 12532
95 % 3 7 12568
90 % 3 7 12392
70 % 47 167 255
50 % 49 182 234
40 % 49 186 240
30 % 49 186 252
Entity #41 | Chains: Ch
40S ribosomal protein S13-like protein protein, length: 151 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 12711
95 % 3 7 12895
90 % 3 7 12728
70 % 47 172 249
50 % 49 179 244
40 % 49 184 242
30 % 49 184 254
Entity #42 | Chains: Ci
40S ribosomal protein S14-like protein protein, length: 150 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13251
95 % 3 7 12908
90 % 7 73 788
70 % 49 180 226
50 % 49 181 236
40 % 49 181 247
30 % 49 181 263
Entity #43 | Chains: Cj
40S ribosomal protein S16-like protein protein, length: 143 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13002
95 % 3 7 12446
90 % 3 7 12280
70 % 3 7 11695
50 % 49 174 256
40 % 49 178 259
30 % 49 179 276
Entity #44 | Chains: Ck
40S ribosomal protein S11-like protein protein, length: 161 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 5 18469
95 % 2 5 17832
90 % 2 5 17491
70 % 41 85 465
50 % 48 179 243
40 % 48 179 253
30 % 48 179 273
Entity #45 | Chains: Cm
40S ribosomal protein S22-like protein protein, length: 130 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13003
95 % 3 7 12354
90 % 3 7 12281
70 % 48 182 235
50 % 51 190 227
40 % 51 190 237
30 % 406 744 24
Entity #46 | Chains: Cn
40S ribosomal protein s23-like protein protein, length: 145 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13297
95 % 3 7 12699
90 % 3 7 12382
70 % 49 186 212
50 % 49 192 224
40 % 49 192 235
30 % 49 192 244
Entity #47 | Chains: Co
40S ribosomal protein S24 protein, length: 136 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 5 19640
95 % 2 5 17864
90 % 2 5 17519
70 % 2 5 16332
50 % 45 174 272
40 % 45 174 284
30 % 45 174 306
Entity #48 | Chains: Cp
40S ribosomal protein S28-like protein protein, length: 68 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13391
95 % 3 7 13193
90 % 3 7 13013
70 % 47 173 248
50 % 49 180 241
40 % 49 181 248
30 % 49 181 269
Entity #49 | Chains: CU
Faf1 protein, length: 311 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 12529
95 % 3 7 12703
90 % 3 7 12822
70 % 3 7 11786
50 % 3 7 10758
40 % 3 7 10131
30 % 3 7 9381
Entity #5 | Chains: UF
Utp6 protein, length: 414 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13415
95 % 3 7 13223
90 % 3 7 12555
70 % 3 7 12390
50 % 3 7 11324
40 % 3 7 10656
30 % 3 7 9856
Entity #50 | Chains: C1
35S ribosomal RNA rna, length: 2352 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
Entity #51 | Chains: C2
U3 snoRNA rna, length: 230 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
Entity #52 | Chains: UV
U3 small nucleolar RNA-associated protein 22 protein, length: 1171 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 4 28853
95 % 1 4 23843
90 % 1 4 20974
70 % 1 4 18721
50 % 1 4 16684
40 % 1 4 17191
30 % 1 4 15447
Entity #53 | Chains: CV
Rrp7 protein, length: 322 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 4 29673
95 % 1 4 24971
90 % 1 4 20912
70 % 1 4 19270
50 % 1 4 19477
40 % 1 4 15811
30 % 1 4 14263
Entity #54 | Chains: CW
Ribosome biogenesis protein ENP2 protein, length: 668 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 4 28091
95 % 2 4 22788
90 % 2 4 22130
70 % 2 4 20282
50 % 2 4 17978
40 % 2 4 16568
30 % 2 4 14924
Entity #55 | Chains: UT
Utp20 protein, length: 2612 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 4 28589
95 % 2 4 22787
90 % 2 4 22129
70 % 2 4 20280
50 % 2 4 17977
40 % 2 4 16567
30 % 2 4 14923
Entity #56 | Chains: UH
Utp8 protein, length: 930 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 6 15987
95 % 3 6 13919
90 % 3 6 15056
70 % 3 6 12973
50 % 3 6 11619
40 % 3 6 11108
30 % 3 6 11004
Entity #57 | Chains: UE,UI
Utp5 protein, length: 410 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 6 6999
95 % 3 6 7589
90 % 3 6 7573
70 % 3 6 7040
50 % 3 6 6677
40 % 3 6 6751
30 % 3 6 6347
Entity #58 | Chains: US
Noc4 protein, length: 549 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 6 16163
95 % 3 6 14198
90 % 3 6 14258
70 % 3 6 14154
50 % 3 6 12288
40 % 3 6 11956
30 % 3 6 10560
Entity #59 | Chains: Cl
Rps18 protein, length: 156 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 6 16763
95 % 3 6 15157
90 % 3 6 14908
70 % 47 165 258
50 % 49 174 257
40 % 49 180 252
30 % 49 180 272
Entity #6 | Chains: UG
Utp7 protein, length: 558 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13061
95 % 3 7 12574
90 % 3 7 12397
70 % 3 7 11796
50 % 3 7 10772
40 % 3 9 7980
30 % 3 9 7959
Entity #60 | Chains: CX
Enp1 protein, length: 480 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 6 17621
95 % 3 6 16483
90 % 3 6 16180
70 % 3 6 15153
50 % 3 6 13677
40 % 3 6 12744
30 % 3 14 5131
Entity #61 | Chains: CY
U3 small nucleolar ribonucleoprotein protein lcp5-like protein protein, length: 381 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 3 34196
95 % 2 3 26887
90 % 2 3 25934
70 % 2 3 23644
50 % 2 3 20767
40 % 2 3 19010
30 % 2 3 17059
Entity #62 | Chains: CZ
Bfr2 protein, length: 609 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 4 25226
95 % 2 4 18806
90 % 2 4 18390
70 % 2 4 17101
50 % 2 4 15385
40 % 2 4 14307
30 % 2 4 13023
Entity #63 | Chains: UP
Utp16 protein, length: 364 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 6 16762
95 % 3 6 15156
90 % 3 6 14136
70 % 3 6 14046
50 % 3 6 12181
40 % 3 6 11389
30 % 3 6 10916
Entity #7 | Chains: UJ
UTP10 protein, length: 1802 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 8 10718
95 % 3 8 11934
90 % 3 8 11756
70 % 3 8 11252
50 % 3 8 10297
40 % 3 8 9712
30 % 3 8 9002
Entity #8 | Chains: UK
U3 small nucleolar RNA-associated protein 11 protein, length: 270 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13413
95 % 3 7 13221
90 % 3 7 13039
70 % 3 7 12388
50 % 3 7 11322
40 % 3 7 10654
30 % 3 7 9539
Entity #9 | Chains: UL
Utp12 protein, length: 962 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13412
95 % 3 7 13220
90 % 3 7 13038
70 % 3 7 12387
50 % 3 7 11321
40 % 3 11 6812
30 % 3 11 6484

Instructions

In the table for each entity, view a list of similar sequences by selecting the link associated with the percentage cutoff.



View more detailed documentation on the redundancy reduction and sequence clustering procedure used by RCSB PDB.

You can also use the structure comparison tool to compare any 2 given structures


ACTION - (A) Select for download / view details OR (B) Select two chains for comparison
Rank PDB ID Entity ID Chains Description Details Taxonomy EC Number
1 1I6U 2 A, B 30S RIBOSOMAL PROTEIN S8P 2190
2 4V88 24 AW, CW 40S ribosomal protein S22-A 4932
3 4U4R 24 D2, d2 40S ribosomal protein S22-A 4932
4 4U3U 24 D2, d2 40S ribosomal protein S22-A 4932
5 5TBW 71 X, d2 40S ribosomal protein S22-A 4932
6 4U3M 24 D2, d2 40S ribosomal protein S22-A 4932
7 4U3N 24 D2, d2 40S ribosomal protein S22-A 4932
8 4U52 24 D2, d2 40S ribosomal protein S22-A 4932
9 4U4Q 24 D2, d2 40S ribosomal protein S22-A 4932
10 4U6F 24 D2, d2 40S ribosomal protein S22-A 4932
11 4U4U 24 D2, d2 40S ribosomal protein S22-A 4932
12 4U4Z 24 D2, d2 40S ribosomal protein S22-A 4932
13 4U4Y 24 D2, d2 40S ribosomal protein S22-A 4932
14 4U4N 24 D2, d2 40S ribosomal protein S22-A 4932
15 4U55 24 D2, d2 40S ribosomal protein S22-A 4932
16 5DAT 24 D2 40S ribosomal protein S22-A 4932
17 5DAT 80 d2 40S ribosomal protein S22-A 4932
18 5I4L 24 D2, d2 40S ribosomal protein S22-A 4932
19 4U51 24 D2, d2 40S ribosomal protein S22-A 4932
20 6HHQ 70 X, d2 40S ribosomal protein S22-A 4932
21 5OBM 68 D2, d2 40S ribosomal protein S22-A 4932
22 4U53 24 D2, d2 40S ribosomal protein S22-A 4932
23 5ON6 72 X, d2 40S ribosomal protein S22-A 4932
24 4U50 24 D2, d2 40S ribosomal protein S22-A 4932
25 5NDV 68 D2, d2 40S ribosomal protein S22-A 4932
26 5LYB 24 D2, d2 40S ribosomal protein S22-A 4932
27 4U56 24 D2, d2 40S ribosomal protein S22-A 4932
28 5TGA 24 D2, d2 40S ribosomal protein S22-A 4932
29 5MEI 71 X, d2 40S ribosomal protein S22-A 4932
30 5FCJ 24 D2, d2 40S ribosomal protein S22-A 4932
31 4U4O 24 D2, d2 40S ribosomal protein S22-A 4932
32 5DGV 24 D2, d2 40S ribosomal protein S22-A 4932
33 5DGE 24 D2, d2 40S ribosomal protein S22-A 4932
34 5NDW 17 D2, d2 40S ribosomal protein S22-A 4932
35 4BTS 18 AH, BH, CH, DH 40S RIBOSOMAL PROTEIN RPS22E 5911
36 5NDG 24 D2, d2 40S ribosomal protein S22-A 4932
37 5FCI 24 D2, d2 40S ribosomal protein S22-A 4932
38 5DC3 24 D2, d2 40S ribosomal protein S22-A 4932
39 5DGF 24 D2, d2 40S ribosomal protein S22-A 4932
40 4V5O 17 AH, BH RIBOSOMAL PROTEIN S8 CONTAINING PROTEIN 5911
41 5TGM 24 D2, d2 40S ribosomal protein S22-A 4932
42 4V7R 16 AO, CO 40S ribosomal protein S22-A 4932
43 5VYC 16 W1, W2, W3, W4, W5, W6 40S ribosomal protein S15a 9606
44 4KZZ 23 W 40S Ribosomal Protein S15A 9986
45 4KZX 23 W 40S ribosomal protein S15A 9986
46 4KZY 23 W 40S Ribosomal Protein S15A 9986
47 6SGC 24 X1 Ribosomal protein S15a 9986
48 6S47 68 BX 40S ribosomal protein S22-A TRSSVLADALNAINNAEKTGKRQVLIRPSSKVIIKFLQVMQKHGYIGEFEYIDDHRSGK IVVQLNGRLNKCGVISPRFNVKIGDIEKWTANLLPARQFGYVILTTSAGIMDHEEARRKH VSGKILGFVY 4932
49 6RXT 41 Cm 40S ribosomal protein S22-like protein 209285
50 6RXU 45 Cm 40S ribosomal protein S22-like protein 209285
51 6RXV 45 Cm 40S ribosomal protein S22-like protein 209285
52 6RXX 26 Cm 40S ribosomal protein S22-like protein 209285
53 6RXY 40 Cm 40S ribosomal protein S22-like protein 209285
54 6RXZ 44 Cm 40S ribosomal protein S22-like protein 209285
55 6P5I 24 X uS8 9986
56 6P5J 24 X uS8 9986
57 6P5K 70 X uS8 9986
58 6P5N 70 X uS8 9986
59 6P4G 24 X uS8 9986
60 6P4H 25 X uS8 9986
61 6OM7 29 SW 40S ribosomal protein S15a 9606
62 6OLZ 69 BW 40S ribosomal protein S15a 9606
63 6OM0 29 SW 40S ribosomal protein S15a 9606
64 6OLE 29 SW 40S ribosomal protein S15a 9606
65 6OLF 29 SW 40S ribosomal protein S15a 9606
66 6OLG 72 BW 40S ribosomal protein S15a 9606
67 6OLI 29 SW 40S ribosomal protein S15a 9606
68 6OKK 11 K 40S ribosomal protein S15A 5833
69 6RBD 15 W 40S ribosomal protein S22-A 4932
70 6RBE 15 W 40S ribosomal protein S22-A 4932
71 6R7Q 82 TT Ribosomal protein S15a 9986
72 6R6G 50 TT Ribosomal protein S15a 9986
73 6R6P 66 TT Ribosomal protein S15a 9986
74 6R5Q 74 TT Ribosomal protein S15a 9986
75 6QZP 76 SW 40S ribosomal protein S15a 9606
76 6Q8Y 27 b 40S ribosomal protein S22-A 4932
77 6I7O 41 b, bb 40S ribosomal protein S22-A 4932
78 6IP5 75 3M 40S ribosomal protein S15a 9606
79 6IP6 74 3M 40S ribosomal protein S15a 9606
80 6IP8 74 3M 40S ribosomal protein S15a 9606
81 6MTB 73 WW 40S ribosomal protein S15a 9986
82 6MTC 72 WW 40S ribosomal protein S15a 9986
83 6MTD 74 WW uS8 9986
84 6MTE 73 WW uS8 9986
85 6HCQ 27 X2 Ribosomal protein S15a 9986
86 6HCJ 27 X2 Ribosomal protein S15a 9986
87 6HCM 24 X1 Ribosomal protein S15a 9986
88 6HCF 24 X1 Ribosomal protein S15a 9986
89 6GZ3 33 BW Ribosomal protein S15a 9986
90 6GZ4 36 BW ribosomal protein uS8 9986
91 6GZ5 33 BW ribosomal protein uS8 9986
92 6GSM 26 W 40S ribosomal protein S22 28985
93 6GSN 40 W 40S ribosomal protein S22 28985
94 6GQV 70 AM 40S ribosomal protein S22-A 4932
95 6GQ1 70 AM 40S ribosomal protein S22-A 4932
96 6GQB 70 AM 40S ribosomal protein S22-A 4932
97 6D9J 72 XX uS8 9986
98 6D90 73 XX uS8 9986
99 6G5H 14 W 40S ribosomal protein S15a 9606
100 6G5I 24 W 40S ribosomal protein S15a 9606
101 6G4S 19 W 40S ribosomal protein S15a 9606
102 6G4W 16 W 40S ribosomal protein S15a 9606
103 6G51 15 W 40S ribosomal protein S15a 9606
104 6G53 15 W 40S ribosomal protein S15a 9606
105 6G18 25 W 40S ribosomal protein S15a 9606
106 6FYX 26 W 40S ribosomal protein S22 28985
107 6FYY 26 W 40S ribosomal protein S22 28985
108 6FEC 29 a 40S ribosomal protein S15a 9606
109 6FAI 33 W 40S ribosomal protein S22-A 4932
110 6EML 24 b 40S ribosomal protein S22-A 4932
111 6EK0 76 SW 40S ribosomal protein S15a 9606
112 6AZ1 10 J ribosomal protein S8 5661
113 5OQL 45 w 40S ribosomal protein S22-like protein 209285
114 5OPT 22 e 40S ribosomal protein S15a, putative 5693
115 5WLC 13 LE rpS22_uS8 4932
116 5XYI 24 W Ribosomal protein S15a 5722
117 5XXU 24 W Ribosomal protein uS8 5811
118 5OA3 27 W 40S ribosomal protein S15a 9606
119 5WYJ 47 SX 40S ribosomal protein S22-A 4932
120 5WYK 43 SX 40S ribosomal protein S22-A 4932
121 5TZS 14 E rpS22_uS8 4932
122 5MC6 29 b 40S ribosomal protein S22-A 4932
123 5M1J 30 W2 40S ribosomal protein S22-A 4932
124 5LZS 73 WW uS8 9986
125 5LZT 74 WW uS8 9986
126 5LZU 73 WW uS8 9986
127 5LZV 74 WW uS8 9986
128 5LZW 74 WW uS8 9986
129 5LZX 74 WW uS8 9986
130 5LZY 72 WW uS8 9986
131 5LZZ 74 WW uS8 9986
132 5T2A 65 AJ uS8 5661
133 5T2C 57 AP 40S ribosomal protein S15a 9606
134 5LL6 14 b 40S ribosomal protein S22-A 4932
135 5LKS 75 SW 40S ribosomal protein S15a 9606
136 5K0Y 23 a ribosomal protein uS8 9986
137 5JUO 72 TB uS8 (yeast S22) 4932
138 5JUP 72 TB uS8 (yeast S22) 4932
139 5JUS 72 TB uS8 (yeast S22) 4932
140 5JUT 72 TB uS8 (yeast S22) 4932
141 5JUU 72 TB uS8 (yeast S22) 4932
142 5JPQ 32 z uS8 209285
143 5JB3 15 I 30S ribosomal protein S8 30S ribosomal protein uS8 model from Pyrococcus furiosus (PDB code 4V6U) used for fitting 29292
144 5JBH 26 I 30S ribosomal protein uS8 30S ribosomal protein uS8 model from Pyrococcus furiosus (PDB code 4V6U) used for fitting 29292
145 5IT7 70 W 40S ribosomal protein S22 28985
146 5IT9 23 W Ribosomal protein uS8 28985
147 5FLX 24 W 40S RIBOSOMAL PROTEIN S15A 9986
148 3JBN 7 K 40S ribosomal protein uS8 5833
149 3JBO 29 K 40S ribosomal protein uS8 5833
150 3JBP 7 K 40S ribosomal protein uS8 5833
151 3JAP 26 W uS8 28985
152 3JAQ 26 W uS8 28985
153 3JAM 24 W uS8 28985
154 3JAN 66 SW Ribosomal protein uS8 SEE REMARK 999 9986
155 3JAJ 67 SW Ribosomal protein uS8 SEE REMARK 999 9986
156 3JAG 74 WW uS8 9986
157 3JAH 74 WW uS8 9986
158 3JAI 74 WW uS8 9986
159 5A2Q 25 W RIBOSOMAL PROTEIN US8 9606
160 4UG0 77 SW 40S RIBOSOMAL PROTEIN S15A 9606
161 5AJ0 72 BW 40S ribosomal protein S15a 9606
162 4UER 18 H US8 4934
163 4D61 24 W 40S RIBOSOMAL PROTEIN S15A 9986
164 4D5L 24 W 40S RIBOSOMAL PROTEIN US8 9986
165 4V3P 27 SH Ribosomal protein S15 4565
166 3J81 24 W uS8 28985
167 3J80 14 W uS8 28985
168 3J7P 72 SW Ribosomal protein uS8 9823
169 3J7R 73 SW Ribosomal protein uS8 9823
170 4UJC 73 CW 40S RIBOSOMAL PROTEIN US8 9986
171 4UJD 73 CW 40S RIBOSOMAL PROTEIN US8 9986
172 3J7A 11 K 40S ribosomal protein uS8 5833
173 3J77 68 22 40S ribosomal protein S22 4932
174 3J78 68 22 40S ribosomal protein S22 4932
175 3J6X 69 22 40S ribosomal protein S22 4932
176 3J6Y 69 22 40S ribosomal protein S22 4932
177 4UJE 27 BW 40S RIBOSOMAL PROTEIN S15A 9986
178 4V92 25 BW US8 28985
179 4V7E 24 BW 40S ribosomal protein S8 4565
180 4V8Y 31 AW 40S RIBOSOMAL PROTEIN S22-A 4932
181 4V8Z 31 AW 40S RIBOSOMAL PROTEIN S22-A 4932
182 4V4N 21 BI 30S ribosomal protein S8P SEE REMARK 999 2190
183 4V6W 32 AW 40S ribosomal protein S15Aa 7227
184 4V6X 32 AW 40S ribosomal protein S15a 9606
185 4V8M 18 AJ 40S RIBOSOMAL PROTEIN S15A, PUTATIVE 185431
186 4V6U 3 AI 30S ribosomal protein S8P 2261
187 4V6I 9 AH 40S ribosomal protein rpS22 (S8p) 4932
188 4V7H 7 AH 40S ribosomal protein S22(A) 5541
189 4V5Z 15 Ah 40S Ribosomal protein S15ae 9612
190 4V4B 8 AH 40S ribosomal protein S22 4932