6RXV

Cryo-EM structure of the 90S pre-ribosome (Kre33-Noc4) from Chaetomium thermophilum, state B2


Sequence Similarity Clusters for the Entities in PDB 6RXV

Entity #1 | Chains: UA
Periodic tryptophan protein 2-like protein protein, length: 904 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13207
95 % 3 7 13555
90 % 3 7 13384
70 % 3 7 12682
50 % 3 11 7514
40 % 3 11 7235
30 % 3 11 6796
Entity #10 | Chains: UM
Utp13 protein, length: 912 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13150
95 % 3 7 13448
90 % 3 7 13278
70 % 3 7 12585
50 % 3 7 11494
40 % 3 7 10804
30 % 3 7 9964
Entity #11 | Chains: UN
Utp14 protein, length: 938 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13536
95 % 3 7 13113
90 % 3 7 13015
70 % 3 7 12280
50 % 3 7 11057
40 % 3 7 10194
30 % 3 7 9610
Entity #12 | Chains: UO
Utp15 protein, length: 557 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 12983
95 % 3 7 13149
90 % 3 7 12962
70 % 3 7 12307
50 % 3 7 11233
40 % 3 7 10547
30 % 3 9 7867
Entity #13 | Chains: UQ
Utp17 protein, length: 960 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13306
95 % 3 7 12851
90 % 3 7 13533
70 % 3 7 11889
50 % 3 7 10834
40 % 3 7 10184
30 % 3 7 9426
Entity #14 | Chains: UR
Utp18 protein, length: 618 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 12870
95 % 3 7 13294
90 % 3 7 13108
70 % 3 7 12439
50 % 3 7 11350
40 % 3 7 10669
30 % 3 11 6608
Entity #15 | Chains: UU
Utp21 protein, length: 1049 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 12765
95 % 3 7 12666
90 % 3 7 12493
70 % 3 7 11904
50 % 3 7 10847
40 % 3 7 10195
30 % 3 7 9436
Entity #16 | Chains: UX
Utp24 protein, length: 193 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 8 12345
95 % 3 8 11721
90 % 3 8 11591
70 % 3 8 11078
50 % 3 12 7008
40 % 3 12 6768
30 % 3 12 6369
Entity #17 | Chains: UZ
Utp30 protein, length: 391 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13074
95 % 3 7 13312
90 % 3 7 13126
70 % 3 7 12454
50 % 3 7 11365
40 % 3 7 10677
30 % 3 7 9852
Entity #18 | Chains: CA,CB
Nop1 protein, length: 313 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 5522
95 % 3 7 6325
90 % 3 7 6341
70 % 3 7 6262
50 % 3 11 3534
40 % 3 11 3520
30 % 3 11 3441
Entity #19 | Chains: CC
Nop56 protein, length: 523 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13206
95 % 3 7 13148
90 % 3 7 12961
70 % 3 7 12306
50 % 3 11 7212
40 % 3 14 5446
30 % 3 14 5203
Entity #2 | Chains: UB
Utp2 protein, length: 907 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13828
95 % 3 7 13670
90 % 3 7 13495
70 % 3 7 12793
50 % 3 7 11685
40 % 3 7 10980
30 % 3 7 10136
Entity #20 | Chains: CD
Nop58 protein, length: 582 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13831
95 % 3 7 13681
90 % 3 7 13502
70 % 3 7 12799
50 % 3 7 11692
40 % 3 7 10987
30 % 3 7 10142
Entity #21 | Chains: CE,CF
Snu13 protein, length: 127 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 5505
95 % 3 7 6303
90 % 3 7 6315
70 % 3 7 6244
50 % 12 34 1379
40 % 13 35 1362
30 % 12 34 1456
Entity #22 | Chains: CG
Rrp9 protein, length: 630 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13662
95 % 3 7 12773
90 % 3 7 13181
70 % 3 7 12379
50 % 3 7 11407
40 % 3 7 10614
30 % 3 7 9798
Entity #23 | Chains: CH
RNA 3'-terminal phosphate cyclase-like protein protein, length: 411 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13702
95 % 3 7 13073
90 % 3 7 13263
70 % 3 7 12572
50 % 3 7 11479
40 % 3 7 10793
30 % 3 7 9955
Entity #24 | Chains: CI
Bms1 protein, length: 1163 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13202
95 % 3 7 13545
90 % 3 7 13378
70 % 3 7 12676
50 % 3 7 11586
40 % 3 11 7266
30 % 3 11 6823
Entity #25 | Chains: CJ
Imp3 protein, length: 183 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 8 11058
95 % 3 8 10671
90 % 3 8 10586
70 % 3 8 11540
50 % 3 12 7052
40 % 3 12 6826
30 % 3 12 6406
Entity #26 | Chains: CK
Imp4 protein, length: 297 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 8 11081
95 % 3 8 10451
90 % 3 8 12137
70 % 3 8 11572
50 % 3 11 7542
40 % 3 11 7263
30 % 3 11 6819
Entity #27 | Chains: CL
Mpp10 protein, length: 785 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13133
95 % 3 7 13418
90 % 3 7 13241
70 % 3 7 12543
50 % 3 7 11452
40 % 3 7 10766
30 % 3 7 9935
Entity #28 | Chains: CM
Sof1 protein, length: 446 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13594
95 % 3 7 13235
90 % 3 7 13043
70 % 3 7 12380
50 % 3 7 11299
40 % 3 9 8483
30 % 3 9 7930
Entity #29 | Chains: CN,CO
Emg1 protein, length: 252 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 5396
95 % 3 7 6095
90 % 3 7 6124
70 % 8 17 2374
50 % 8 17 2404
40 % 8 17 2425
30 % 8 17 2453
Entity #3 | Chains: UC
Utp3 protein, length: 648 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 12841
95 % 3 7 12843
90 % 3 7 12657
70 % 3 7 11875
50 % 3 7 10983
40 % 3 7 10324
30 % 3 7 9543
Entity #30 | Chains: CP
KRR1 small subunit processome component protein, length: 322 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 8 9545
95 % 3 8 10194
90 % 3 8 10117
70 % 3 11 7211
50 % 3 11 7115
40 % 3 11 6873
30 % 3 11 6459
Entity #31 | Chains: CQ
Pre-rRNA-processing protein PNO1 protein, length: 259 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13408
95 % 3 7 13425
90 % 3 7 12693
70 % 3 7 12144
50 % 3 7 11003
40 % 3 7 10336
30 % 3 7 9558
Entity #32 | Chains: CR,CS
Kre33 protein, length: 1073 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 8 4192
95 % 3 8 5126
90 % 3 8 5194
70 % 3 8 5144
50 % 3 8 4995
40 % 3 8 4867
30 % 3 8 4697
Entity #33 | Chains: CT
Fcf2 protein, length: 203 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 12738
95 % 3 7 12653
90 % 3 7 12567
70 % 3 7 11855
50 % 3 7 10808
40 % 3 7 10255
30 % 3 7 9490
Entity #34 | Chains: Ca
40S ribosomal protein S1 protein, length: 255 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 5 18549
95 % 3 5 17671
90 % 3 5 17358
70 % 49 89 456
50 % 54 145 354
40 % 56 152 349
30 % 56 152 364
Entity #35 | Chains: Cb
40S ribosomal protein S4 protein, length: 264 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 5 20343
95 % 2 5 18610
90 % 2 5 18278
70 % 53 171 266
50 % 55 181 258
40 % 55 185 263
30 % 59 194 258
Entity #36 | Chains: Cc
40S ribosomal protein s5-like protein protein, length: 212 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13809
95 % 3 7 13623
90 % 3 7 13454
70 % 8 93 647
50 % 57 191 236
40 % 57 191 247
30 % 57 191 262
Entity #37 | Chains: Cd
40S ribosomal protein S6 protein, length: 239 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 5 20342
95 % 2 5 18609
90 % 2 5 18277
70 % 7 83 736
50 % 54 172 301
40 % 54 177 297
30 % 54 177 323
Entity #38 | Chains: Ce
40S ribosomal protein S7 protein, length: 203 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13811
95 % 3 7 13625
90 % 3 7 13456
70 % 3 7 12755
50 % 54 178 277
40 % 54 178 290
30 % 56 181 291
Entity #39 | Chains: Cf
40S ribosomal protein S8 protein, length: 202 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 5 19805
95 % 2 5 17518
90 % 2 5 17376
70 % 48 91 447
50 % 55 180 260
40 % 55 184 267
30 % 55 184 282
Entity #4 | Chains: UD
Utp4 protein, length: 884 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 4 8 9271
95 % 4 8 10154
90 % 4 8 10075
70 % 4 8 9758
50 % 4 8 9092
40 % 4 8 8684
30 % 4 8 8109
Entity #40 | Chains: Cg
40S ribosomal protein s9-like protein protein, length: 190 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13648
95 % 3 7 13332
90 % 3 7 13150
70 % 55 175 253
50 % 57 190 239
40 % 61 198 233
30 % 61 198 249
Entity #41 | Chains: Ch
40S ribosomal protein S13-like protein protein, length: 151 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13454
95 % 3 7 12958
90 % 3 7 12777
70 % 55 180 247
50 % 57 187 243
40 % 61 195 238
30 % 61 196 254
Entity #42 | Chains: Ci
40S ribosomal protein S14-like protein protein, length: 150 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 12833
95 % 3 7 13016
90 % 7 73 809
70 % 57 188 220
50 % 57 189 240
40 % 57 189 252
30 % 57 189 267
Entity #43 | Chains: Cj
40S ribosomal protein S16-like protein protein, length: 143 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13386
95 % 3 7 12821
90 % 3 7 12539
70 % 3 7 12033
50 % 57 182 253
40 % 61 190 249
30 % 61 191 263
Entity #44 | Chains: Ck
40S ribosomal protein S11-like protein protein, length: 161 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 5 20207
95 % 2 5 18365
90 % 2 5 18047
70 % 49 93 435
50 % 56 187 242
40 % 56 187 255
30 % 56 187 269
Entity #45 | Chains: Cm
40S ribosomal protein S22-like protein protein, length: 130 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13796
95 % 3 7 13063
90 % 3 7 13438
70 % 56 191 223
50 % 63 202 215
40 % 63 202 229
30 % 425 763 22
Entity #46 | Chains: Cn
40S ribosomal protein s23-like protein protein, length: 145 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13081
95 % 3 7 13319
90 % 3 7 13138
70 % 57 194 197
50 % 61 204 211
40 % 61 204 227
30 % 61 204 244
Entity #47 | Chains: Co
40S ribosomal protein S24 protein, length: 136 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 5 18989
95 % 2 5 18419
90 % 2 5 18102
70 % 48 93 438
50 % 53 182 268
40 % 53 182 279
30 % 53 182 304
Entity #48 | Chains: Cp
40S ribosomal protein S28-like protein protein, length: 68 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13649
95 % 3 7 13333
90 % 3 7 13342
70 % 55 181 244
50 % 61 192 233
40 % 61 193 242
30 % 61 193 257
Entity #49 | Chains: CU
Faf1 protein, length: 311 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13387
95 % 3 7 12822
90 % 3 7 12640
70 % 3 7 12034
50 % 3 7 10972
40 % 3 7 10315
30 % 3 7 9537
Entity #5 | Chains: UF
Utp6 protein, length: 414 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13242
95 % 3 7 13554
90 % 3 7 13257
70 % 3 7 12681
50 % 3 7 11592
40 % 3 7 10891
30 % 3 7 10047
Entity #50 | Chains: C1
35S ribosomal RNA rna, length: 2352 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
Entity #51 | Chains: C2
U3 snoRNA rna, length: 230 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
Entity #52 | Chains: UV
U3 small nucleolar RNA-associated protein 22 protein, length: 1171 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 4 30533
95 % 1 4 25672
90 % 1 4 24842
70 % 1 4 22653
50 % 1 4 19953
40 % 1 4 18274
30 % 1 4 16400
Entity #53 | Chains: CV
Rrp7 protein, length: 322 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 4 25820
95 % 1 4 26295
90 % 1 4 25215
70 % 1 4 22969
50 % 1 4 20357
40 % 1 4 18500
30 % 1 4 16591
Entity #54 | Chains: CW
Ribosome biogenesis protein ENP2 protein, length: 668 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 4 28887
95 % 2 4 23406
90 % 2 4 22733
70 % 2 4 20806
50 % 2 4 18421
40 % 2 4 16926
30 % 2 4 15269
Entity #55 | Chains: UT
Utp20 protein, length: 2612 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 4 24042
95 % 2 4 25917
90 % 2 4 25086
70 % 2 4 22858
50 % 2 4 18738
40 % 2 4 18417
30 % 2 4 15507
Entity #56 | Chains: UH
Utp8 protein, length: 930 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 6 16064
95 % 3 6 17074
90 % 3 6 16775
70 % 3 6 15684
50 % 3 6 14155
40 % 3 6 13153
30 % 3 6 12005
Entity #57 | Chains: UE,UI
Utp5 protein, length: 410 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 6 7234
95 % 3 6 7825
90 % 3 6 7797
70 % 3 6 7603
50 % 3 6 7151
40 % 3 6 6904
30 % 3 6 6481
Entity #58 | Chains: US
Noc4 protein, length: 549 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 6 17319
95 % 3 6 15703
90 % 3 6 14423
70 % 3 6 13894
50 % 3 6 12621
40 % 3 6 11790
30 % 3 6 11255
Entity #59 | Chains: Cl
Rps18 protein, length: 156 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 6 16063
95 % 3 6 17073
90 % 3 6 16774
70 % 55 173 260
50 % 57 182 255
40 % 61 192 246
30 % 61 192 261
Entity #6 | Chains: UG
Utp7 protein, length: 558 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13827
95 % 3 7 13669
90 % 3 7 13494
70 % 3 7 12792
50 % 3 7 11684
40 % 3 9 8738
30 % 3 9 7626
Entity #60 | Chains: CX
Enp1 protein, length: 480 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 6 16062
95 % 3 6 16941
90 % 3 6 16773
70 % 3 6 15581
50 % 3 6 14154
40 % 3 6 13152
30 % 4 15 5117
Entity #61 | Chains: CY
U3 small nucleolar ribonucleoprotein protein lcp5-like protein protein, length: 381 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 3 34424
95 % 2 3 26463
90 % 2 3 26181
70 % 2 3 23305
50 % 2 3 20485
40 % 2 3 19149
30 % 2 3 17174
Entity #62 | Chains: CZ
Bfr2 protein, length: 609 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 4 27677
95 % 2 4 21729
90 % 2 4 21200
70 % 2 4 19514
50 % 2 4 17379
40 % 2 4 16019
30 % 2 4 14492
Entity #63 | Chains: UP
Utp16 protein, length: 364 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 6 16132
95 % 3 6 13801
90 % 3 6 13621
70 % 3 6 12907
50 % 3 6 11792
40 % 3 6 11076
30 % 3 6 10218
Entity #7 | Chains: UJ
UTP10 protein, length: 1802 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 8 10579
95 % 3 8 11552
90 % 3 8 11428
70 % 3 8 10929
50 % 3 8 10065
40 % 3 8 9565
30 % 3 8 8858
Entity #8 | Chains: UK
U3 small nucleolar RNA-associated protein 11 protein, length: 270 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13428
95 % 3 7 12909
90 % 3 7 12729
70 % 3 7 12101
50 % 3 7 11038
40 % 3 7 10373
30 % 3 7 9592
Entity #9 | Chains: UL
Utp12 protein, length: 962 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 12842
95 % 3 7 13170
90 % 3 7 12658
70 % 3 7 12043
50 % 3 7 10984
40 % 3 11 7038
30 % 3 11 6609

Instructions

In the table for each entity, view a list of similar sequences by selecting the link associated with the percentage cutoff.



View more detailed documentation on the redundancy reduction and sequence clustering procedure used by RCSB PDB.

You can also use the structure comparison tool to compare any 2 given structures


ACTION - (A) Select for download / view details OR (B) Select two chains for comparison
Rank PDB ID Entity ID Chains Description Details Taxonomy EC Number
1 1I6U 2 A, B 30S RIBOSOMAL PROTEIN S8P 2190
2 4V88 24 AW, CW 40S ribosomal protein S22-A 4932
3 4U4R 24 D2, d2 40S ribosomal protein S22-A 4932
4 4U3U 24 D2, d2 40S ribosomal protein S22-A 4932
5 5TBW 71 X, d2 40S ribosomal protein S22-A 4932
6 4U3M 24 D2, d2 40S ribosomal protein S22-A 4932
7 4U3N 24 D2, d2 40S ribosomal protein S22-A 4932
8 4U52 24 D2, d2 40S ribosomal protein S22-A 4932
9 4U4Q 24 D2, d2 40S ribosomal protein S22-A 4932
10 4U6F 24 D2, d2 40S ribosomal protein S22-A 4932
11 4U4U 24 D2, d2 40S ribosomal protein S22-A 4932
12 4U4Z 24 D2, d2 40S ribosomal protein S22-A 4932
13 4U4Y 24 D2, d2 40S ribosomal protein S22-A 4932
14 4U4N 24 D2, d2 40S ribosomal protein S22-A 4932
15 4U55 24 D2, d2 40S ribosomal protein S22-A 4932
16 5DAT 24 D2 40S ribosomal protein S22-A 4932
17 5DAT 80 d2 40S ribosomal protein S22-A 4932
18 5I4L 24 D2, d2 40S ribosomal protein S22-A 4932
19 4U51 24 D2, d2 40S ribosomal protein S22-A 4932
20 6HHQ 70 X, d2 40S ribosomal protein S22-A 4932
21 5OBM 68 D2, d2 40S ribosomal protein S22-A 4932
22 4U53 24 D2, d2 40S ribosomal protein S22-A 4932
23 5ON6 72 X, d2 40S ribosomal protein S22-A 4932
24 4U50 24 D2, d2 40S ribosomal protein S22-A 4932
25 5NDV 68 D2, d2 40S ribosomal protein S22-A 4932
26 5LYB 24 D2, d2 40S ribosomal protein S22-A 4932
27 4U56 24 D2, d2 40S ribosomal protein S22-A 4932
28 5TGA 24 D2, d2 40S ribosomal protein S22-A 4932
29 5MEI 71 X, d2 40S ribosomal protein S22-A 4932
30 5FCJ 24 D2, d2 40S ribosomal protein S22-A 4932
31 4U4O 24 D2, d2 40S ribosomal protein S22-A 4932
32 5DGV 24 D2, d2 40S ribosomal protein S22-A 4932
33 5DGE 24 D2, d2 40S ribosomal protein S22-A 4932
34 5NDW 17 D2, d2 40S ribosomal protein S22-A 4932
35 4BTS 18 AH, BH, CH, DH 40S RIBOSOMAL PROTEIN RPS22E 5911
36 5NDG 24 D2, d2 40S ribosomal protein S22-A 4932
37 5FCI 24 D2, d2 40S ribosomal protein S22-A 4932
38 5DC3 24 D2, d2 40S ribosomal protein S22-A 4932
39 5DGF 24 D2, d2 40S ribosomal protein S22-A 4932
40 4V5O 17 AH, BH RIBOSOMAL PROTEIN S8 CONTAINING PROTEIN 5911
41 5TGM 24 D2, d2 40S ribosomal protein S22-A 4932
42 4V7R 16 AO, CO 40S ribosomal protein S22-A 4932
43 5VYC 16 W1, W2, W3, W4, W5, W6 40S ribosomal protein S15a 9606
44 4KZZ 23 W 40S Ribosomal Protein S15A 9986
45 4KZX 23 W 40S ribosomal protein S15A 9986
46 4KZY 23 W 40S Ribosomal Protein S15A 9986
47 6Y7C 22 W 40S ribosomal protein S22-A 4932
48 6TMF 10 J 30S ribosomal protein S8 2264
49 6UZ7 70 W 40S ribosomal protein S22 28985
50 6T83 24 Wb, x 40S ribosomal protein S22-A 4932
51 6T7T 26 SW 40S ribosomal protein S22-A 4932
52 6T7I 24 SW 40S ribosomal protein S22-A 4932
53 6T4Q 23 SW 40S ribosomal protein S22-A 4932
54 6SW9 10 I 30S ribosomal protein S8 29292
55 6SWC 10 I 30S ribosomal protein S8 29292
56 6SWD 9 I 30S ribosomal protein S8 29292
57 6SV4 41 b, bb, bc 40S ribosomal protein S22-A 4932
58 6SNT 24 W 40S ribosomal protein S22-A 4932
59 6SGC 24 X1 Ribosomal protein S15a 9986
60 6S47 68 BX 40S ribosomal protein S22-A TRSSVLADALNAINNAEKTGKRQVLIRPSSKVIIKFLQVMQKHGYIGEFEYIDDHRSGK IVVQLNGRLNKCGVISPRFNVKIGDIEKWTANLLPARQFGYVILTTSAGIMDHEEARRKH VSGKILGFVY 4932
61 6RXT 41 Cm 40S ribosomal protein S22-like protein 209285
62 6RXU 45 Cm 40S ribosomal protein S22-like protein 209285
63 6RXV 45 Cm 40S ribosomal protein S22-like protein 209285
64 6RXX 26 Cm 40S ribosomal protein S22-like protein 209285
65 6RXY 40 Cm 40S ribosomal protein S22-like protein 209285
66 6RXZ 44 Cm 40S ribosomal protein S22-like protein 209285
67 6P5I 24 X uS8 9986
68 6P5J 24 X uS8 9986
69 6P5K 70 X uS8 9986
70 6P5N 70 X uS8 9986
71 6P4G 24 X uS8 9986
72 6P4H 25 X uS8 9986
73 6OM7 29 SW 40S ribosomal protein S15a 9606
74 6OLZ 69 BW 40S ribosomal protein S15a 9606
75 6OM0 29 SW 40S ribosomal protein S15a 9606
76 6OLE 29 SW 40S ribosomal protein S15a 9606
77 6OLF 29 SW 40S ribosomal protein S15a 9606
78 6OLG 72 BW 40S ribosomal protein S15a 9606
79 6OLI 29 SW 40S ribosomal protein S15a 9606
80 6OKK 11 K 40S ribosomal protein S15A 5833
81 6RBD 15 W 40S ribosomal protein S22-A 4932
82 6RBE 15 W 40S ribosomal protein S22-A 4932
83 6R7Q 82 TT Ribosomal protein S15a 9986
84 6R6G 50 TT Ribosomal protein S15a 9986
85 6R6P 66 TT Ribosomal protein S15a 9986
86 6R5Q 74 TT Ribosomal protein S15a 9986
87 6QZP 76 SW 40S ribosomal protein S15a 9606
88 6Q8Y 27 b 40S ribosomal protein S22-A 4932
89 6I7O 41 b, bb 40S ribosomal protein S22-A 4932
90 6IP5 75 3M 40S ribosomal protein S15a 9606
91 6IP6 74 3M 40S ribosomal protein S15a 9606
92 6IP8 74 3M 40S ribosomal protein S15a 9606
93 6MTB 73 WW 40S ribosomal protein S15a 9986
94 6MTC 72 WW 40S ribosomal protein S15a 9986
95 6MTD 74 WW uS8 9986
96 6MTE 73 WW uS8 9986
97 6HCQ 27 X2 Ribosomal protein S15a 9986
98 6HCJ 27 X2 Ribosomal protein S15a 9986
99 6HCM 24 X1 Ribosomal protein S15a 9986
100 6HCF 24 X1 Ribosomal protein S15a 9986
101 6GZ3 33 BW Ribosomal protein S15a 9986
102 6GZ4 36 BW ribosomal protein uS8 9986
103 6GZ5 33 BW ribosomal protein uS8 9986
104 6GSM 26 W 40S ribosomal protein S22 28985
105 6GSN 40 W 40S ribosomal protein S22 28985
106 6GQV 70 AM 40S ribosomal protein S22-A 4932
107 6GQ1 70 AM 40S ribosomal protein S22-A 4932
108 6GQB 70 AM 40S ribosomal protein S22-A 4932
109 6D9J 72 XX uS8 9986
110 6D90 73 XX uS8 9986
111 6G5H 14 W 40S ribosomal protein S15a 9606
112 6G5I 24 W 40S ribosomal protein S15a 9606
113 6G4S 19 W 40S ribosomal protein S15a 9606
114 6G4W 16 W 40S ribosomal protein S15a 9606
115 6G51 15 W 40S ribosomal protein S15a 9606
116 6G53 15 W 40S ribosomal protein S15a 9606
117 6G18 25 W 40S ribosomal protein S15a 9606
118 6FYX 26 W 40S ribosomal protein S22 28985
119 6FYY 26 W 40S ribosomal protein S22 28985
120 6FEC 29 a 40S ribosomal protein S15a 9606
121 6FAI 33 W 40S ribosomal protein S22-A 4932
122 6EML 24 b 40S ribosomal protein S22-A 4932
123 6EK0 76 SW 40S ribosomal protein S15a 9606
124 6AZ1 10 J ribosomal protein S8 5661
125 5OQL 45 w 40S ribosomal protein S22-like protein 209285
126 5OPT 22 e 40S ribosomal protein S15a, putative 5693
127 5WLC 13 LE rpS22_uS8 4932
128 5XYI 24 W Ribosomal protein S15a 5722
129 5XXU 24 W Ribosomal protein uS8 5811
130 5OA3 27 W 40S ribosomal protein S15a 9606
131 5WYJ 47 SX 40S ribosomal protein S22-A 4932
132 5WYK 43 SX 40S ribosomal protein S22-A 4932
133 5TZS 14 E rpS22_uS8 4932
134 5MC6 29 b 40S ribosomal protein S22-A 4932
135 5M1J 30 W2 40S ribosomal protein S22-A 4932
136 5LZS 73 WW uS8 9986
137 5LZT 74 WW uS8 9986
138 5LZU 73 WW uS8 9986
139 5LZV 74 WW uS8 9986
140 5LZW 74 WW uS8 9986
141 5LZX 74 WW uS8 9986
142 5LZY 72 WW uS8 9986
143 5LZZ 74 WW uS8 9986
144 5T2A 65 AJ uS8 5661
145 5T2C 57 AP 40S ribosomal protein S15a 9606
146 5LL6 14 b 40S ribosomal protein S22-A 4932
147 5LKS 75 SW 40S ribosomal protein S15a 9606
148 5K0Y 23 a ribosomal protein uS8 9986
149 5JUO 72 TB uS8 (yeast S22) 4932
150 5JUP 72 TB uS8 (yeast S22) 4932
151 5JUS 72 TB uS8 (yeast S22) 4932
152 5JUT 72 TB uS8 (yeast S22) 4932
153 5JUU 72 TB uS8 (yeast S22) 4932
154 5JPQ 32 z uS8 209285
155 5JB3 15 I 30S ribosomal protein S8 30S ribosomal protein uS8 model from Pyrococcus furiosus (PDB code 4V6U) used for fitting 29292
156 5JBH 26 I 30S ribosomal protein uS8 30S ribosomal protein uS8 model from Pyrococcus furiosus (PDB code 4V6U) used for fitting 29292
157 5IT7 70 W 40S ribosomal protein S22 28985
158 5IT9 23 W Ribosomal protein uS8 28985
159 5FLX 24 W 40S RIBOSOMAL PROTEIN S15A 9986
160 3JBN 7 K 40S ribosomal protein uS8 5833
161 3JBO 29 K 40S ribosomal protein uS8 5833
162 3JBP 7 K 40S ribosomal protein uS8 5833
163 3JAP 26 W uS8 28985
164 3JAQ 26 W uS8 28985
165 3JAM 24 W uS8 28985
166 3JAN 66 SW Ribosomal protein uS8 SEE REMARK 999 9986
167 3JAJ 67 SW Ribosomal protein uS8 SEE REMARK 999 9986
168 3JAG 74 WW uS8 9986
169 3JAH 74 WW uS8 9986
170 3JAI 74 WW uS8 9986
171 5A2Q 25 W RIBOSOMAL PROTEIN US8 9606
172 4UG0 77 SW 40S RIBOSOMAL PROTEIN S15A 9606
173 5AJ0 72 BW 40S ribosomal protein S15a 9606
174 4UER 18 H US8 4934
175 4D61 24 W 40S RIBOSOMAL PROTEIN S15A 9986
176 4D5L 24 W 40S RIBOSOMAL PROTEIN US8 9986
177 4V3P 27 SH Ribosomal protein S15 4565
178 3J81 24 W uS8 28985
179 3J80 14 W uS8 28985
180 3J7P 72 SW Ribosomal protein uS8 9823
181 3J7R 73 SW Ribosomal protein uS8 9823
182 4UJC 73 CW 40S RIBOSOMAL PROTEIN US8 9986
183 4UJD 73 CW 40S RIBOSOMAL PROTEIN US8 9986
184 3J7A 11 K 40S ribosomal protein uS8 5833
185 3J77 68 22 40S ribosomal protein S22 4932
186 3J78 68 22 40S ribosomal protein S22 4932
187 3J6X 69 22 40S ribosomal protein S22 4932
188 3J6Y 69 22 40S ribosomal protein S22 4932
189 4UJE 27 BW 40S RIBOSOMAL PROTEIN S15A 9986
190 4V92 25 BW US8 28985
191 4V7E 24 BW 40S ribosomal protein S8 4565
192 4V8Y 31 AW 40S RIBOSOMAL PROTEIN S22-A 4932
193 4V8Z 31 AW 40S RIBOSOMAL PROTEIN S22-A 4932
194 4V4N 21 BI 30S ribosomal protein S8P SEE REMARK 999 2190
195 4V6W 32 AW 40S ribosomal protein S15Aa 7227
196 4V6X 32 AW 40S ribosomal protein S15a 9606
197 4V8M 18 AJ 40S RIBOSOMAL PROTEIN S15A, PUTATIVE 185431
198 4V6U 3 AI 30S ribosomal protein S8P 2261
199 4V6I 9 AH 40S ribosomal protein rpS22 (S8p) 4932
200 4V7H 7 AH 40S ribosomal protein S22(A) 5541
201 4V5Z 15 Ah 40S Ribosomal protein S15ae 9612
202 4V4B 8 AH 40S ribosomal protein S22 4932