6RXV

Cryo-EM structure of the 90S pre-ribosome (Kre33-Noc4) from Chaetomium thermophilum, state B2


Sequence Similarity Clusters for the Entities in PDB 6RXV

Entity #1 | Chains: UA
Periodic tryptophan protein 2-like protein protein, length: 904 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13092
95 % 3 7 12500
90 % 3 7 12306
70 % 3 7 11725
50 % 3 11 7127
40 % 3 11 6871
30 % 3 11 6447
Entity #10 | Chains: UM
Utp13 protein, length: 912 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 12541
95 % 3 7 12456
90 % 3 7 12520
70 % 3 7 11685
50 % 3 7 10890
40 % 3 7 10244
30 % 3 7 9295
Entity #11 | Chains: UN
Utp14 protein, length: 938 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 12903
95 % 3 7 13216
90 % 3 7 13030
70 % 3 7 12350
50 % 3 7 11301
40 % 3 7 10632
30 % 3 7 9809
Entity #12 | Chains: UO
Utp15 protein, length: 557 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13383
95 % 3 7 13055
90 % 3 7 12863
70 % 3 7 12214
50 % 3 7 11167
40 % 3 7 10510
30 % 3 9 7877
Entity #13 | Chains: UQ
Utp17 protein, length: 960 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13156
95 % 3 7 12599
90 % 3 7 12402
70 % 3 7 11802
50 % 3 7 10792
40 % 3 7 10153
30 % 3 7 9383
Entity #14 | Chains: UR
Utp18 protein, length: 618 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 12756
95 % 3 7 12916
90 % 3 7 12726
70 % 3 7 12104
50 % 3 7 11058
40 % 3 7 10393
30 % 3 11 6614
Entity #15 | Chains: UU
Utp21 protein, length: 1049 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13155
95 % 3 7 12598
90 % 3 7 12401
70 % 3 7 11801
50 % 3 7 10791
40 % 3 7 10152
30 % 3 7 9382
Entity #16 | Chains: UX
Utp24 protein, length: 193 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 8 12132
95 % 3 8 11533
90 % 3 8 11361
70 % 3 8 10886
50 % 3 12 6452
40 % 3 12 6252
30 % 3 12 5935
Entity #17 | Chains: UZ
Utp30 protein, length: 391 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13036
95 % 3 7 13315
90 % 3 7 13264
70 % 3 7 12105
50 % 3 7 11059
40 % 3 7 10394
30 % 3 7 9591
Entity #18 | Chains: CA,CB
Nop1 protein, length: 313 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 5426
95 % 3 7 6229
90 % 3 7 6252
70 % 3 7 6165
50 % 3 11 3621
40 % 3 11 3605
30 % 3 11 3523
Entity #19 | Chains: CC
Nop56 protein, length: 523 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13154
95 % 3 7 12597
90 % 3 7 12400
70 % 3 7 11800
50 % 3 11 7120
40 % 3 15 5060
30 % 3 15 4857
Entity #2 | Chains: UB
Utp2 protein, length: 907 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13552
95 % 3 7 13443
90 % 3 7 12761
70 % 3 7 12125
50 % 3 7 11464
40 % 3 7 10780
30 % 3 7 9939
Entity #20 | Chains: CD
Nop58 protein, length: 582 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 12639
95 % 3 7 12820
90 % 3 7 12623
70 % 3 7 11887
50 % 3 7 10870
40 % 3 7 10314
30 % 3 7 9520
Entity #21 | Chains: CE,CF
Snu13 protein, length: 127 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 5425
95 % 3 7 6228
90 % 3 7 6251
70 % 3 7 6164
50 % 12 34 1339
40 % 13 35 1328
30 % 12 34 1419
Entity #22 | Chains: CG
Rrp9 protein, length: 630 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 12884
95 % 3 7 13173
90 % 3 7 12994
70 % 3 7 12312
50 % 3 7 11263
40 % 3 7 10601
30 % 3 7 9775
Entity #23 | Chains: CH
RNA 3'-terminal phosphate cyclase-like protein protein, length: 411 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13348
95 % 3 7 12986
90 % 3 7 12797
70 % 3 7 12157
50 % 3 7 11114
40 % 3 7 10447
30 % 3 7 9638
Entity #24 | Chains: CI
Bms1 protein, length: 1163 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 12956
95 % 3 7 13309
90 % 3 7 13119
70 % 3 7 12434
50 % 3 7 11387
40 % 3 11 7171
30 % 3 11 6737
Entity #25 | Chains: CJ
Imp3 protein, length: 183 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 8 12134
95 % 3 8 11813
90 % 3 8 11644
70 % 3 8 11122
50 % 3 12 6862
40 % 3 12 6637
30 % 3 12 6251
Entity #26 | Chains: CK
Imp4 protein, length: 297 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 8 12133
95 % 3 8 10220
90 % 3 8 11643
70 % 3 8 9806
50 % 3 11 7441
40 % 3 11 7167
30 % 3 11 6734
Entity #27 | Chains: CL
Mpp10 protein, length: 785 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13349
95 % 3 7 12987
90 % 3 7 12798
70 % 3 7 11900
50 % 3 7 11115
40 % 3 7 10234
30 % 3 7 9639
Entity #28 | Chains: CM
Sof1 protein, length: 446 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13350
95 % 3 7 12988
90 % 3 7 12799
70 % 3 7 12158
50 % 3 7 11116
40 % 3 9 8359
30 % 3 9 7806
Entity #29 | Chains: CN,CO
Emg1 protein, length: 252 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 4990
95 % 3 7 5911
90 % 3 7 5956
70 % 8 17 2319
50 % 8 17 2371
40 % 8 17 2388
30 % 8 17 2378
Entity #3 | Chains: UC
Utp3 protein, length: 648 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13093
95 % 3 7 12956
90 % 3 7 12307
70 % 3 7 11726
50 % 3 7 10714
40 % 3 7 10081
30 % 3 7 9323
Entity #30 | Chains: CP
KRR1 small subunit processome component protein, length: 322 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 8 9285
95 % 3 8 9519
90 % 3 8 9452
70 % 3 11 6841
50 % 3 11 6500
40 % 3 11 6297
30 % 3 11 5965
Entity #31 | Chains: CQ
Pre-rRNA-processing protein PNO1 protein, length: 259 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 12757
95 % 3 7 12917
90 % 3 7 12727
70 % 3 7 12106
50 % 3 7 11061
40 % 3 7 10395
30 % 3 7 9592
Entity #32 | Chains: CR,CS
Kre33 protein, length: 1073 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 8 4095
95 % 3 8 5017
90 % 3 8 5074
70 % 3 8 5020
50 % 3 8 4873
40 % 3 8 4765
30 % 3 8 4610
Entity #33 | Chains: CT
Fcf2 protein, length: 203 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 12958
95 % 3 7 13314
90 % 3 7 13123
70 % 3 7 12437
50 % 3 7 11389
40 % 3 7 10711
30 % 3 7 9876
Entity #34 | Chains: Ca
40S ribosomal protein S1 protein, length: 255 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 5 18280
95 % 3 5 17403
90 % 3 5 17055
70 % 46 86 468
50 % 51 142 348
40 % 53 149 346
30 % 53 149 362
Entity #35 | Chains: Cb
40S ribosomal protein S4 protein, length: 264 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 5 17910
95 % 2 5 16818
90 % 2 5 16580
70 % 50 168 264
50 % 52 178 261
40 % 52 182 263
30 % 52 187 263
Entity #36 | Chains: Cc
40S ribosomal protein s5-like protein protein, length: 212 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13545
95 % 3 7 13387
90 % 3 7 13204
70 % 8 93 626
50 % 54 188 233
40 % 54 188 241
30 % 54 188 253
Entity #37 | Chains: Cd
40S ribosomal protein S6 protein, length: 239 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 5 19391
95 % 2 5 17254
90 % 2 5 16919
70 % 7 83 712
50 % 51 169 299
40 % 51 174 300
30 % 51 174 324
Entity #38 | Chains: Ce
40S ribosomal protein S7 protein, length: 203 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13224
95 % 3 7 12747
90 % 3 7 12546
70 % 3 7 11937
50 % 51 175 282
40 % 51 175 293
30 % 53 178 296
Entity #39 | Chains: Cf
40S ribosomal protein S8 protein, length: 202 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 5 19390
95 % 2 5 17253
90 % 2 5 16918
70 % 45 88 456
50 % 52 177 265
40 % 52 181 264
30 % 52 181 285
Entity #4 | Chains: UD
Utp4 protein, length: 884 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 4 8 9204
95 % 4 8 9366
90 % 4 8 9295
70 % 4 8 9033
50 % 4 8 8393
40 % 4 8 8070
30 % 4 8 7528
Entity #40 | Chains: Cg
40S ribosomal protein s9-like protein protein, length: 190 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13223
95 % 3 7 12746
90 % 3 7 12545
70 % 52 172 257
50 % 54 187 234
40 % 54 191 239
30 % 54 191 249
Entity #41 | Chains: Ch
40S ribosomal protein S13-like protein protein, length: 151 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13255
95 % 3 7 12802
90 % 3 7 12605
70 % 52 181 243
50 % 54 184 241
40 % 54 189 240
30 % 54 189 252
Entity #42 | Chains: Ci
40S ribosomal protein S14-like protein protein, length: 150 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13301
95 % 3 7 12894
90 % 7 73 795
70 % 54 185 219
50 % 54 186 235
40 % 54 186 245
30 % 54 186 260
Entity #43 | Chains: Cj
40S ribosomal protein S16-like protein protein, length: 143 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13225
95 % 3 7 12748
90 % 3 7 12547
70 % 3 7 11938
50 % 54 179 252
40 % 54 183 253
30 % 54 184 267
Entity #44 | Chains: Ck
40S ribosomal protein S11-like protein protein, length: 161 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 5 19896
95 % 2 5 18070
90 % 2 5 17727
70 % 46 90 438
50 % 53 184 240
40 % 53 184 248
30 % 53 184 266
Entity #45 | Chains: Cm
40S ribosomal protein S22-like protein protein, length: 130 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13398
95 % 3 7 13085
90 % 3 7 12903
70 % 53 188 227
50 % 56 195 228
40 % 56 195 235
30 % 414 752 23
Entity #46 | Chains: Cn
40S ribosomal protein s23-like protein protein, length: 145 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13440
95 % 3 7 12719
90 % 3 7 12670
70 % 54 191 210
50 % 54 197 224
40 % 54 197 232
30 % 54 197 245
Entity #47 | Chains: Co
40S ribosomal protein S24 protein, length: 136 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 5 20258
95 % 2 5 18233
90 % 2 5 18170
70 % 2 5 16212
50 % 50 179 270
40 % 50 179 281
30 % 50 179 305
Entity #48 | Chains: Cp
40S ribosomal protein S28-like protein protein, length: 68 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13302
95 % 3 7 12895
90 % 3 7 12993
70 % 52 178 249
50 % 54 185 236
40 % 54 186 244
30 % 54 186 258
Entity #49 | Chains: CU
Faf1 protein, length: 311 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13399
95 % 3 7 13086
90 % 3 7 12904
70 % 3 7 12406
50 % 3 7 11357
40 % 3 7 10681
30 % 3 7 9716
Entity #5 | Chains: UF
Utp6 protein, length: 414 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 12962
95 % 3 7 13317
90 % 3 7 13213
70 % 3 7 12444
50 % 3 7 11393
40 % 3 7 10714
30 % 3 7 9882
Entity #50 | Chains: C1
35S ribosomal RNA rna, length: 2352 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
Entity #51 | Chains: C2
U3 snoRNA rna, length: 230 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
Entity #52 | Chains: UV
U3 small nucleolar RNA-associated protein 22 protein, length: 1171 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 4 29130
95 % 1 4 24091
90 % 1 4 23359
70 % 1 4 19517
50 % 1 4 17345
40 % 1 4 17358
30 % 1 4 15636
Entity #53 | Chains: CV
Rrp7 protein, length: 322 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 4 25361
95 % 1 4 25637
90 % 1 4 24819
70 % 1 4 22643
50 % 1 4 19951
40 % 1 4 18284
30 % 1 4 16405
Entity #54 | Chains: CW
Ribosome biogenesis protein ENP2 protein, length: 668 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 4 26688
95 % 2 4 20737
90 % 2 4 20240
70 % 2 4 18678
50 % 2 4 18149
40 % 2 4 16722
30 % 2 4 13984
Entity #55 | Chains: UT
Utp20 protein, length: 2612 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 4 30240
95 % 2 4 23535
90 % 2 4 22838
70 % 2 4 22516
50 % 2 4 19846
40 % 2 4 18201
30 % 2 4 15367
Entity #56 | Chains: UH
Utp8 protein, length: 930 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 6 16152
95 % 3 6 13749
90 % 3 6 13529
70 % 3 6 12679
50 % 3 6 11992
40 % 3 6 11261
30 % 3 6 10361
Entity #57 | Chains: UE,UI
Utp5 protein, length: 410 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 6 6668
95 % 3 6 7271
90 % 3 6 7260
70 % 3 6 6809
50 % 3 6 6479
40 % 3 6 6524
30 % 3 6 6175
Entity #58 | Chains: US
Noc4 protein, length: 549 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 6 16321
95 % 3 6 15418
90 % 3 6 15178
70 % 3 6 13625
50 % 3 6 12968
40 % 3 6 12090
30 % 3 6 11085
Entity #59 | Chains: Cl
Rps18 protein, length: 156 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 6 17347
95 % 3 6 15905
90 % 3 6 15653
70 % 52 170 260
50 % 54 179 258
40 % 54 185 247
30 % 54 185 265
Entity #6 | Chains: UG
Utp7 protein, length: 558 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 12961
95 % 3 7 13316
90 % 3 7 13128
70 % 3 7 12443
50 % 3 7 11392
40 % 3 9 8134
30 % 3 9 7579
Entity #60 | Chains: CX
Enp1 protein, length: 480 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 6 17817
95 % 3 6 16669
90 % 3 6 16375
70 % 3 6 15311
50 % 3 6 13841
40 % 3 6 12871
30 % 3 14 5191
Entity #61 | Chains: CY
U3 small nucleolar ribonucleoprotein protein lcp5-like protein protein, length: 381 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 3 33848
95 % 2 3 26678
90 % 2 3 25755
70 % 2 3 22994
50 % 2 3 20237
40 % 2 3 18530
30 % 2 3 16620
Entity #62 | Chains: CZ
Bfr2 protein, length: 609 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 4 28348
95 % 2 4 23046
90 % 2 4 22396
70 % 2 4 20514
50 % 2 4 18161
40 % 2 4 16735
30 % 2 4 15131
Entity #63 | Chains: UP
Utp16 protein, length: 364 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 6 15827
95 % 3 6 14263
90 % 3 6 15941
70 % 3 6 12676
50 % 3 6 11595
40 % 3 6 10905
30 % 3 6 10063
Entity #7 | Chains: UJ
UTP10 protein, length: 1802 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 8 10870
95 % 3 8 12096
90 % 3 8 11922
70 % 3 8 11347
50 % 3 8 10410
40 % 3 8 9813
30 % 3 8 9086
Entity #8 | Chains: UK
U3 small nucleolar RNA-associated protein 11 protein, length: 270 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 12963
95 % 3 7 13318
90 % 3 7 13129
70 % 3 7 12445
50 % 3 7 11394
40 % 3 7 10715
30 % 3 7 9883
Entity #9 | Chains: UL
Utp12 protein, length: 962 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13578
95 % 3 7 13432
90 % 3 7 13243
70 % 3 7 12561
50 % 3 7 11499
40 % 3 11 6977
30 % 3 11 6538

Instructions

In the table for each entity, view a list of similar sequences by selecting the link associated with the percentage cutoff.



View more detailed documentation on the redundancy reduction and sequence clustering procedure used by RCSB PDB.

You can also use the structure comparison tool to compare any 2 given structures


ACTION - (A) Select for download / view details OR (B) Select two chains for comparison
Rank PDB ID Entity ID Chains Description Details Taxonomy EC Number
1 1I6U 2 A, B 30S RIBOSOMAL PROTEIN S8P 2190
2 4V88 24 AW, CW 40S ribosomal protein S22-A 4932
3 4U4R 24 D2, d2 40S ribosomal protein S22-A 4932
4 4U3U 24 D2, d2 40S ribosomal protein S22-A 4932
5 5TBW 71 X, d2 40S ribosomal protein S22-A 4932
6 4U3M 24 D2, d2 40S ribosomal protein S22-A 4932
7 4U3N 24 D2, d2 40S ribosomal protein S22-A 4932
8 4U52 24 D2, d2 40S ribosomal protein S22-A 4932
9 4U4Q 24 D2, d2 40S ribosomal protein S22-A 4932
10 4U6F 24 D2, d2 40S ribosomal protein S22-A 4932
11 4U4U 24 D2, d2 40S ribosomal protein S22-A 4932
12 4U4Z 24 D2, d2 40S ribosomal protein S22-A 4932
13 4U4Y 24 D2, d2 40S ribosomal protein S22-A 4932
14 4U4N 24 D2, d2 40S ribosomal protein S22-A 4932
15 4U55 24 D2, d2 40S ribosomal protein S22-A 4932
16 5DAT 24 D2 40S ribosomal protein S22-A 4932
17 5DAT 80 d2 40S ribosomal protein S22-A 4932
18 5I4L 24 D2, d2 40S ribosomal protein S22-A 4932
19 4U51 24 D2, d2 40S ribosomal protein S22-A 4932
20 6HHQ 70 X, d2 40S ribosomal protein S22-A 4932
21 5OBM 68 D2, d2 40S ribosomal protein S22-A 4932
22 4U53 24 D2, d2 40S ribosomal protein S22-A 4932
23 5ON6 72 X, d2 40S ribosomal protein S22-A 4932
24 4U50 24 D2, d2 40S ribosomal protein S22-A 4932
25 5NDV 68 D2, d2 40S ribosomal protein S22-A 4932
26 5LYB 24 D2, d2 40S ribosomal protein S22-A 4932
27 4U56 24 D2, d2 40S ribosomal protein S22-A 4932
28 5TGA 24 D2, d2 40S ribosomal protein S22-A 4932
29 5MEI 71 X, d2 40S ribosomal protein S22-A 4932
30 5FCJ 24 D2, d2 40S ribosomal protein S22-A 4932
31 4U4O 24 D2, d2 40S ribosomal protein S22-A 4932
32 5DGV 24 D2, d2 40S ribosomal protein S22-A 4932
33 5DGE 24 D2, d2 40S ribosomal protein S22-A 4932
34 5NDW 17 D2, d2 40S ribosomal protein S22-A 4932
35 4BTS 18 AH, BH, CH, DH 40S RIBOSOMAL PROTEIN RPS22E 5911
36 5NDG 24 D2, d2 40S ribosomal protein S22-A 4932
37 5FCI 24 D2, d2 40S ribosomal protein S22-A 4932
38 5DC3 24 D2, d2 40S ribosomal protein S22-A 4932
39 5DGF 24 D2, d2 40S ribosomal protein S22-A 4932
40 4V5O 17 AH, BH RIBOSOMAL PROTEIN S8 CONTAINING PROTEIN 5911
41 5TGM 24 D2, d2 40S ribosomal protein S22-A 4932
42 4V7R 16 AO, CO 40S ribosomal protein S22-A 4932
43 5VYC 16 W1, W2, W3, W4, W5, W6 40S ribosomal protein S15a 9606
44 4KZZ 23 W 40S Ribosomal Protein S15A 9986
45 4KZX 23 W 40S ribosomal protein S15A 9986
46 4KZY 23 W 40S Ribosomal Protein S15A 9986
47 6UZ7 70 W 40S ribosomal protein S22 28985
48 6T83 24 Wb, x 40S ribosomal protein S22-A 4932
49 6T7T 24 SW 40S ribosomal protein S22-A 4932
50 6T7I 24 SW 40S ribosomal protein S22-A 4932
51 6T4Q 23 SW 40S ribosomal protein S22-A 4932
52 6SGC 24 X1 Ribosomal protein S15a 9986
53 6S47 68 BX 40S ribosomal protein S22-A TRSSVLADALNAINNAEKTGKRQVLIRPSSKVIIKFLQVMQKHGYIGEFEYIDDHRSGK IVVQLNGRLNKCGVISPRFNVKIGDIEKWTANLLPARQFGYVILTTSAGIMDHEEARRKH VSGKILGFVY 4932
54 6RXT 41 Cm 40S ribosomal protein S22-like protein 209285
55 6RXU 45 Cm 40S ribosomal protein S22-like protein 209285
56 6RXV 45 Cm 40S ribosomal protein S22-like protein 209285
57 6RXX 26 Cm 40S ribosomal protein S22-like protein 209285
58 6RXY 40 Cm 40S ribosomal protein S22-like protein 209285
59 6RXZ 44 Cm 40S ribosomal protein S22-like protein 209285
60 6P5I 24 X uS8 9986
61 6P5J 24 X uS8 9986
62 6P5K 70 X uS8 9986
63 6P5N 70 X uS8 9986
64 6P4G 24 X uS8 9986
65 6P4H 25 X uS8 9986
66 6OM7 29 SW 40S ribosomal protein S15a 9606
67 6OLZ 69 BW 40S ribosomal protein S15a 9606
68 6OM0 29 SW 40S ribosomal protein S15a 9606
69 6OLE 29 SW 40S ribosomal protein S15a 9606
70 6OLF 29 SW 40S ribosomal protein S15a 9606
71 6OLG 72 BW 40S ribosomal protein S15a 9606
72 6OLI 29 SW 40S ribosomal protein S15a 9606
73 6OKK 11 K 40S ribosomal protein S15A 5833
74 6RBD 15 W 40S ribosomal protein S22-A 4932
75 6RBE 15 W 40S ribosomal protein S22-A 4932
76 6R7Q 82 TT Ribosomal protein S15a 9986
77 6R6G 50 TT Ribosomal protein S15a 9986
78 6R6P 66 TT Ribosomal protein S15a 9986
79 6R5Q 74 TT Ribosomal protein S15a 9986
80 6QZP 76 SW 40S ribosomal protein S15a 9606
81 6Q8Y 27 b 40S ribosomal protein S22-A 4932
82 6I7O 41 b, bb 40S ribosomal protein S22-A 4932
83 6IP5 75 3M 40S ribosomal protein S15a 9606
84 6IP6 74 3M 40S ribosomal protein S15a 9606
85 6IP8 74 3M 40S ribosomal protein S15a 9606
86 6MTB 73 WW 40S ribosomal protein S15a 9986
87 6MTC 72 WW 40S ribosomal protein S15a 9986
88 6MTD 74 WW uS8 9986
89 6MTE 73 WW uS8 9986
90 6HCQ 27 X2 Ribosomal protein S15a 9986
91 6HCJ 27 X2 Ribosomal protein S15a 9986
92 6HCM 24 X1 Ribosomal protein S15a 9986
93 6HCF 24 X1 Ribosomal protein S15a 9986
94 6GZ3 33 BW Ribosomal protein S15a 9986
95 6GZ4 36 BW ribosomal protein uS8 9986
96 6GZ5 33 BW ribosomal protein uS8 9986
97 6GSM 26 W 40S ribosomal protein S22 28985
98 6GSN 40 W 40S ribosomal protein S22 28985
99 6GQV 70 AM 40S ribosomal protein S22-A 4932
100 6GQ1 70 AM 40S ribosomal protein S22-A 4932
101 6GQB 70 AM 40S ribosomal protein S22-A 4932
102 6D9J 72 XX uS8 9986
103 6D90 73 XX uS8 9986
104 6G5H 14 W 40S ribosomal protein S15a 9606
105 6G5I 24 W 40S ribosomal protein S15a 9606
106 6G4S 19 W 40S ribosomal protein S15a 9606
107 6G4W 16 W 40S ribosomal protein S15a 9606
108 6G51 15 W 40S ribosomal protein S15a 9606
109 6G53 15 W 40S ribosomal protein S15a 9606
110 6G18 25 W 40S ribosomal protein S15a 9606
111 6FYX 26 W 40S ribosomal protein S22 28985
112 6FYY 26 W 40S ribosomal protein S22 28985
113 6FEC 29 a 40S ribosomal protein S15a 9606
114 6FAI 33 W 40S ribosomal protein S22-A 4932
115 6EML 24 b 40S ribosomal protein S22-A 4932
116 6EK0 76 SW 40S ribosomal protein S15a 9606
117 6AZ1 10 J ribosomal protein S8 5661
118 5OQL 45 w 40S ribosomal protein S22-like protein 209285
119 5OPT 22 e 40S ribosomal protein S15a, putative 5693
120 5WLC 13 LE rpS22_uS8 4932
121 5XYI 24 W Ribosomal protein S15a 5722
122 5XXU 24 W Ribosomal protein uS8 5811
123 5OA3 27 W 40S ribosomal protein S15a 9606
124 5WYJ 47 SX 40S ribosomal protein S22-A 4932
125 5WYK 43 SX 40S ribosomal protein S22-A 4932
126 5TZS 14 E rpS22_uS8 4932
127 5MC6 29 b 40S ribosomal protein S22-A 4932
128 5M1J 30 W2 40S ribosomal protein S22-A 4932
129 5LZS 73 WW uS8 9986
130 5LZT 74 WW uS8 9986
131 5LZU 73 WW uS8 9986
132 5LZV 74 WW uS8 9986
133 5LZW 74 WW uS8 9986
134 5LZX 74 WW uS8 9986
135 5LZY 72 WW uS8 9986
136 5LZZ 74 WW uS8 9986
137 5T2A 65 AJ uS8 5661
138 5T2C 57 AP 40S ribosomal protein S15a 9606
139 5LL6 14 b 40S ribosomal protein S22-A 4932
140 5LKS 75 SW 40S ribosomal protein S15a 9606
141 5K0Y 23 a ribosomal protein uS8 9986
142 5JUO 72 TB uS8 (yeast S22) 4932
143 5JUP 72 TB uS8 (yeast S22) 4932
144 5JUS 72 TB uS8 (yeast S22) 4932
145 5JUT 72 TB uS8 (yeast S22) 4932
146 5JUU 72 TB uS8 (yeast S22) 4932
147 5JPQ 32 z uS8 209285
148 5JB3 15 I 30S ribosomal protein S8 30S ribosomal protein uS8 model from Pyrococcus furiosus (PDB code 4V6U) used for fitting 29292
149 5JBH 26 I 30S ribosomal protein uS8 30S ribosomal protein uS8 model from Pyrococcus furiosus (PDB code 4V6U) used for fitting 29292
150 5IT7 70 W 40S ribosomal protein S22 28985
151 5IT9 23 W Ribosomal protein uS8 28985
152 5FLX 24 W 40S RIBOSOMAL PROTEIN S15A 9986
153 3JBN 7 K 40S ribosomal protein uS8 5833
154 3JBO 29 K 40S ribosomal protein uS8 5833
155 3JBP 7 K 40S ribosomal protein uS8 5833
156 3JAP 26 W uS8 28985
157 3JAQ 26 W uS8 28985
158 3JAM 24 W uS8 28985
159 3JAN 66 SW Ribosomal protein uS8 SEE REMARK 999 9986
160 3JAJ 67 SW Ribosomal protein uS8 SEE REMARK 999 9986
161 3JAG 74 WW uS8 9986
162 3JAH 74 WW uS8 9986
163 3JAI 74 WW uS8 9986
164 5A2Q 25 W RIBOSOMAL PROTEIN US8 9606
165 4UG0 77 SW 40S RIBOSOMAL PROTEIN S15A 9606
166 5AJ0 72 BW 40S ribosomal protein S15a 9606
167 4UER 18 H US8 4934
168 4D61 24 W 40S RIBOSOMAL PROTEIN S15A 9986
169 4D5L 24 W 40S RIBOSOMAL PROTEIN US8 9986
170 4V3P 27 SH Ribosomal protein S15 4565
171 3J81 24 W uS8 28985
172 3J80 14 W uS8 28985
173 3J7P 72 SW Ribosomal protein uS8 9823
174 3J7R 73 SW Ribosomal protein uS8 9823
175 4UJC 73 CW 40S RIBOSOMAL PROTEIN US8 9986
176 4UJD 73 CW 40S RIBOSOMAL PROTEIN US8 9986
177 3J7A 11 K 40S ribosomal protein uS8 5833
178 3J77 68 22 40S ribosomal protein S22 4932
179 3J78 68 22 40S ribosomal protein S22 4932
180 3J6X 69 22 40S ribosomal protein S22 4932
181 3J6Y 69 22 40S ribosomal protein S22 4932
182 4UJE 27 BW 40S RIBOSOMAL PROTEIN S15A 9986
183 4V92 25 BW US8 28985
184 4V7E 24 BW 40S ribosomal protein S8 4565
185 4V8Y 31 AW 40S RIBOSOMAL PROTEIN S22-A 4932
186 4V8Z 31 AW 40S RIBOSOMAL PROTEIN S22-A 4932
187 4V4N 21 BI 30S ribosomal protein S8P SEE REMARK 999 2190
188 4V6W 32 AW 40S ribosomal protein S15Aa 7227
189 4V6X 32 AW 40S ribosomal protein S15a 9606
190 4V8M 18 AJ 40S RIBOSOMAL PROTEIN S15A, PUTATIVE 185431
191 4V6U 3 AI 30S ribosomal protein S8P 2261
192 4V6I 9 AH 40S ribosomal protein rpS22 (S8p) 4932
193 4V7H 7 AH 40S ribosomal protein S22(A) 5541
194 4V5Z 15 Ah 40S Ribosomal protein S15ae 9612
195 4V4B 8 AH 40S ribosomal protein S22 4932