6RXV

Cryo-EM structure of the 90S pre-ribosome (Kre33-Noc4) from Chaetomium thermophilum, state B2


Sequence Similarity Clusters for the Entities in PDB 6RXV

Entity #1 | Chains: UA
Periodic tryptophan protein 2-like protein protein, length: 904 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 12918
95 % 3 7 13298
90 % 3 7 13117
70 % 3 7 12413
50 % 3 11 7398
40 % 3 11 7127
30 % 3 11 6692
Entity #10 | Chains: UM
Utp13 protein, length: 912 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 12513
95 % 3 7 12448
90 % 3 7 12265
70 % 3 7 11653
50 % 3 7 10659
40 % 3 7 10029
30 % 3 7 9279
Entity #11 | Chains: UN
Utp14 protein, length: 938 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 12876
95 % 3 7 13204
90 % 3 7 13016
70 % 3 7 12312
50 % 3 7 11289
40 % 3 7 10616
30 % 3 7 9795
Entity #12 | Chains: UO
Utp15 protein, length: 557 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13103
95 % 3 7 12451
90 % 3 7 12267
70 % 3 7 11778
50 % 3 7 10662
40 % 3 7 10136
30 % 3 9 7858
Entity #13 | Chains: UQ
Utp17 protein, length: 960 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 12514
95 % 3 7 12708
90 % 3 7 12266
70 % 3 7 11654
50 % 3 7 10660
40 % 3 7 10231
30 % 3 7 9280
Entity #14 | Chains: UR
Utp18 protein, length: 618 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13015
95 % 3 7 12430
90 % 3 7 12243
70 % 3 7 11635
50 % 3 7 10639
40 % 3 7 10013
30 % 3 11 6523
Entity #15 | Chains: UU
Utp21 protein, length: 1049 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13337
95 % 3 7 13036
90 % 3 7 12864
70 % 3 7 12175
50 % 3 7 11140
40 % 3 7 10476
30 % 3 7 9678
Entity #16 | Chains: UX
Utp24 protein, length: 193 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 8 11065
95 % 3 8 11491
90 % 3 8 11356
70 % 3 8 10881
50 % 3 12 6905
40 % 3 12 6655
30 % 3 12 6284
Entity #17 | Chains: UZ
Utp30 protein, length: 391 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 12515
95 % 3 7 12449
90 % 3 7 12525
70 % 3 7 11655
50 % 3 7 10661
40 % 3 7 10030
30 % 3 7 9281
Entity #18 | Chains: CA,CB
Nop1 protein, length: 313 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 5317
95 % 3 7 6036
90 % 3 7 6056
70 % 3 7 5963
50 % 3 11 3612
40 % 3 11 3592
30 % 3 11 3513
Entity #19 | Chains: CC
Nop56 protein, length: 523 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13102
95 % 3 7 12579
90 % 3 7 12403
70 % 3 7 11777
50 % 3 11 7196
40 % 3 14 5673
30 % 3 14 5210
Entity #2 | Chains: UB
Utp2 protein, length: 907 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13048
95 % 3 7 12941
90 % 3 7 12307
70 % 3 7 12087
50 % 3 7 10702
40 % 3 7 10064
30 % 3 7 9309
Entity #20 | Chains: CD
Nop58 protein, length: 582 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13533
95 % 3 7 13374
90 % 3 7 13192
70 % 3 7 12501
50 % 3 7 11447
40 % 3 7 10764
30 % 3 7 9927
Entity #21 | Chains: CE,CF
Snu13 protein, length: 127 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 4988
95 % 3 7 6237
90 % 3 7 6250
70 % 3 7 5850
50 % 12 34 1337
40 % 13 35 1317
30 % 12 34 1420
Entity #22 | Chains: CG
Rrp9 protein, length: 630 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13051
95 % 3 7 12641
90 % 3 7 12309
70 % 3 7 11695
50 % 3 7 10706
40 % 3 7 10067
30 % 3 7 9314
Entity #23 | Chains: CH
RNA 3'-terminal phosphate cyclase-like protein protein, length: 411 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 12913
95 % 3 7 13292
90 % 3 7 13108
70 % 3 7 12405
50 % 3 7 11373
40 % 3 7 10694
30 % 3 7 9870
Entity #24 | Chains: CI
Bms1 protein, length: 1163 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13306
95 % 3 7 12987
90 % 3 7 12809
70 % 3 7 12125
50 % 3 7 11097
40 % 3 11 7155
30 % 3 11 6716
Entity #25 | Chains: CJ
Imp3 protein, length: 183 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 8 10822
95 % 3 8 10276
90 % 3 8 10170
70 % 3 8 9834
50 % 3 12 6954
40 % 3 12 6125
30 % 3 12 5822
Entity #26 | Chains: CK
Imp4 protein, length: 297 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 8 9950
95 % 3 8 10693
90 % 3 8 10577
70 % 3 8 10191
50 % 3 11 7432
40 % 3 11 7154
30 % 3 11 6715
Entity #27 | Chains: CL
Mpp10 protein, length: 785 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13039
95 % 3 7 13291
90 % 3 7 12298
70 % 3 7 12404
50 % 3 7 10697
40 % 3 7 10059
30 % 3 7 9868
Entity #28 | Chains: CM
Sof1 protein, length: 446 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13307
95 % 3 7 12988
90 % 3 7 12810
70 % 3 7 12126
50 % 3 7 11098
40 % 3 9 8347
30 % 3 9 7791
Entity #29 | Chains: CN,CO
Emg1 protein, length: 252 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 5339
95 % 3 7 5730
90 % 3 7 6100
70 % 8 17 2343
50 % 8 17 2360
40 % 8 17 2409
30 % 8 17 2399
Entity #3 | Chains: UC
Utp3 protein, length: 648 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 12917
95 % 3 7 13297
90 % 3 7 13116
70 % 3 7 12412
50 % 3 7 11380
40 % 3 7 10699
30 % 3 7 9875
Entity #30 | Chains: CP
KRR1 small subunit processome component protein, length: 322 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 8 9517
95 % 3 8 10021
90 % 3 8 9932
70 % 3 11 7070
50 % 3 11 7010
40 % 3 11 6762
30 % 3 11 6359
Entity #31 | Chains: CQ
Pre-rRNA-processing protein PNO1 protein, length: 259 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13133
95 % 3 7 12637
90 % 3 7 12455
70 % 3 7 11818
50 % 3 7 10819
40 % 3 7 10171
30 % 3 7 9403
Entity #32 | Chains: CR,CS
Kre33 protein, length: 1073 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 8 4346
95 % 3 8 5230
90 % 3 8 5273
70 % 3 8 5228
50 % 3 8 5051
40 % 3 8 4912
30 % 3 8 4730
Entity #33 | Chains: CT
Fcf2 protein, length: 203 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 12665
95 % 3 7 12756
90 % 3 7 12581
70 % 3 7 11938
50 % 3 7 10930
40 % 3 7 10279
30 % 3 7 9499
Entity #34 | Chains: Ca
40S ribosomal protein S1 protein, length: 255 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 5 17927
95 % 3 5 16797
90 % 3 5 16503
70 % 46 86 470
50 % 51 142 350
40 % 53 149 346
30 % 53 149 362
Entity #35 | Chains: Cb
40S ribosomal protein S4 protein, length: 264 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 5 19368
95 % 2 5 17234
90 % 2 5 16910
70 % 50 168 264
50 % 52 178 259
40 % 52 182 260
30 % 52 187 261
Entity #36 | Chains: Cc
40S ribosomal protein s5-like protein protein, length: 212 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 12646
95 % 3 7 12719
90 % 3 7 13028
70 % 8 93 636
50 % 54 188 231
40 % 54 188 240
30 % 54 188 251
Entity #37 | Chains: Cd
40S ribosomal protein S6 protein, length: 239 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 5 19367
95 % 2 5 17411
90 % 2 5 16909
70 % 7 83 713
50 % 51 169 301
40 % 51 174 301
30 % 51 174 323
Entity #38 | Chains: Ce
40S ribosomal protein S7 protein, length: 203 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 12493
95 % 3 7 12405
90 % 3 7 12903
70 % 3 7 11612
50 % 51 175 282
40 % 51 175 294
30 % 53 178 294
Entity #39 | Chains: Cf
40S ribosomal protein S8 protein, length: 202 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 5 20214
95 % 2 5 18663
90 % 2 5 18282
70 % 45 88 459
50 % 52 177 262
40 % 52 181 262
30 % 52 181 283
Entity #4 | Chains: UD
Utp4 protein, length: 884 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 4 8 9242
95 % 4 8 9496
90 % 4 8 9405
70 % 4 8 9136
50 % 4 8 8498
40 % 4 8 8150
30 % 4 8 7605
Entity #40 | Chains: Cg
40S ribosomal protein s9-like protein protein, length: 190 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13243
95 % 3 7 12875
90 % 3 7 12696
70 % 52 172 258
50 % 54 187 232
40 % 54 191 236
30 % 54 191 248
Entity #41 | Chains: Ch
40S ribosomal protein S13-like protein protein, length: 151 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 12808
95 % 3 7 13058
90 % 3 7 12890
70 % 52 177 250
50 % 54 184 238
40 % 54 189 238
30 % 54 189 249
Entity #42 | Chains: Ci
40S ribosomal protein S14-like protein protein, length: 150 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13362
95 % 3 7 13072
90 % 7 73 799
70 % 54 185 219
50 % 54 186 233
40 % 54 186 244
30 % 54 186 262
Entity #43 | Chains: Cj
40S ribosomal protein S16-like protein protein, length: 143 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13110
95 % 3 7 12591
90 % 3 7 12416
70 % 3 7 11696
50 % 54 179 254
40 % 54 183 252
30 % 54 184 269
Entity #44 | Chains: Ck
40S ribosomal protein S11-like protein protein, length: 161 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 5 18667
95 % 2 5 18288
90 % 2 5 17686
70 % 46 90 443
50 % 53 184 236
40 % 53 184 246
30 % 53 184 265
Entity #45 | Chains: Cm
40S ribosomal protein S22-like protein protein, length: 130 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13513
95 % 3 7 12830
90 % 3 7 12646
70 % 53 188 225
50 % 55 191 230
40 % 55 191 237
30 % 414 752 23
Entity #46 | Chains: Cn
40S ribosomal protein s23-like protein protein, length: 145 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13244
95 % 3 7 12876
90 % 3 7 12697
70 % 54 191 210
50 % 54 197 220
40 % 54 197 229
30 % 54 197 243
Entity #47 | Chains: Co
40S ribosomal protein S24 protein, length: 136 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 5 20231
95 % 2 5 18236
90 % 2 5 17372
70 % 45 90 447
50 % 50 179 267
40 % 50 179 282
30 % 50 179 305
Entity #48 | Chains: Cp
40S ribosomal protein S28-like protein protein, length: 68 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13111
95 % 3 7 12592
90 % 3 7 12417
70 % 52 178 248
50 % 54 185 234
40 % 54 186 242
30 % 54 186 258
Entity #49 | Chains: CU
Faf1 protein, length: 311 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13112
95 % 3 7 12593
90 % 3 7 12418
70 % 3 7 11788
50 % 3 7 10785
40 % 3 7 10145
30 % 3 7 9385
Entity #5 | Chains: UF
Utp6 protein, length: 414 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13531
95 % 3 7 12936
90 % 3 7 13239
70 % 3 7 12494
50 % 3 7 11442
40 % 3 7 10758
30 % 3 7 9923
Entity #50 | Chains: C1
35S ribosomal RNA rna, length: 2352 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
Entity #51 | Chains: C2
U3 snoRNA rna, length: 230 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
Entity #52 | Chains: UV
U3 small nucleolar RNA-associated protein 22 protein, length: 1171 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 4 29982
95 % 1 4 22129
90 % 1 4 21543
70 % 1 4 19410
50 % 1 4 17574
40 % 1 4 16216
30 % 1 4 14437
Entity #53 | Chains: CV
Rrp7 protein, length: 322 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 4 25398
95 % 1 4 25613
90 % 1 4 24784
70 % 1 4 22603
50 % 1 4 20084
40 % 1 4 18244
30 % 1 4 16498
Entity #54 | Chains: CW
Ribosome biogenesis protein ENP2 protein, length: 668 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 4 28370
95 % 2 4 23005
90 % 2 4 22370
70 % 2 4 20472
50 % 2 4 18164
40 % 2 4 16715
30 % 2 4 15064
Entity #55 | Chains: UT
Utp20 protein, length: 2612 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 4 30308
95 % 2 4 25867
90 % 2 4 25014
70 % 2 4 22796
50 % 2 4 20082
40 % 2 4 18384
30 % 2 4 16496
Entity #56 | Chains: UH
Utp8 protein, length: 930 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 6 17784
95 % 3 6 16647
90 % 3 6 15089
70 % 3 6 15274
50 % 3 6 13824
40 % 3 6 12863
30 % 3 6 11752
Entity #57 | Chains: UE,UI
Utp5 protein, length: 410 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 6 7103
95 % 3 6 7748
90 % 3 6 7676
70 % 3 6 7483
50 % 3 6 7038
40 % 3 6 6793
30 % 3 6 6402
Entity #58 | Chains: US
Noc4 protein, length: 549 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 6 17783
95 % 3 6 14379
90 % 3 6 16355
70 % 3 6 15273
50 % 3 6 13823
40 % 3 6 12862
30 % 3 6 11751
Entity #59 | Chains: Cl
Rps18 protein, length: 156 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 6 16324
95 % 3 6 14341
90 % 3 6 14121
70 % 52 170 260
50 % 54 179 252
40 % 54 185 245
30 % 54 185 263
Entity #6 | Chains: UG
Utp7 protein, length: 558 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13558
95 % 3 7 13404
90 % 3 7 13223
70 % 3 7 12532
50 % 3 7 11471
40 % 3 9 8106
30 % 3 9 7573
Entity #60 | Chains: CX
Enp1 protein, length: 480 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 6 16325
95 % 3 6 14342
90 % 3 6 14122
70 % 3 6 13330
50 % 3 6 12161
40 % 3 6 11406
30 % 3 14 5378
Entity #61 | Chains: CY
U3 small nucleolar ribonucleoprotein protein lcp5-like protein protein, length: 381 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 3 34938
95 % 2 3 27653
90 % 2 3 26685
70 % 2 3 24209
50 % 2 3 21275
40 % 2 3 19425
30 % 2 3 17425
Entity #62 | Chains: CZ
Bfr2 protein, length: 609 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 4 24873
95 % 2 4 25180
90 % 2 4 24374
70 % 2 4 22242
50 % 2 4 19631
40 % 2 4 18003
30 % 2 4 16159
Entity #63 | Chains: UP
Utp16 protein, length: 364 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 6 16872
95 % 3 6 15223
90 % 3 6 14959
70 % 3 6 14073
50 % 3 6 12818
40 % 3 6 11978
30 % 3 6 10972
Entity #7 | Chains: UJ
UTP10 protein, length: 1802 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 8 10365
95 % 3 8 11317
90 % 3 8 11186
70 % 3 8 10741
50 % 3 8 9905
40 % 3 8 9395
30 % 3 8 8699
Entity #8 | Chains: UK
U3 small nucleolar RNA-associated protein 11 protein, length: 270 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13530
95 % 3 7 13369
90 % 3 7 13186
70 % 3 7 12493
50 % 3 7 11441
40 % 3 7 10757
30 % 3 7 9922
Entity #9 | Chains: UL
Utp12 protein, length: 962 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13529
95 % 3 7 13368
90 % 3 7 13185
70 % 3 7 12492
50 % 3 7 11440
40 % 3 11 6857
30 % 3 11 6524

Instructions

In the table for each entity, view a list of similar sequences by selecting the link associated with the percentage cutoff.



View more detailed documentation on the redundancy reduction and sequence clustering procedure used by RCSB PDB.

You can also use the structure comparison tool to compare any 2 given structures


ACTION - (A) Select for download / view details OR (B) Select two chains for comparison
Rank PDB ID Entity ID Chains Description Details Taxonomy EC Number
1 4V88 24 AW, CW 40S ribosomal protein S22-A 4932
2 4U4R 24 D2, d2 40S ribosomal protein S22-A 4932
3 4U3U 24 D2, d2 40S ribosomal protein S22-A 4932
4 5TBW 71 X, d2 40S ribosomal protein S22-A 4932
5 4U3M 24 D2, d2 40S ribosomal protein S22-A 4932
6 4U3N 24 D2, d2 40S ribosomal protein S22-A 4932
7 4U52 24 D2, d2 40S ribosomal protein S22-A 4932
8 4U4Q 24 D2, d2 40S ribosomal protein S22-A 4932
9 4U6F 24 D2, d2 40S ribosomal protein S22-A 4932
10 4U4U 24 D2, d2 40S ribosomal protein S22-A 4932
11 4U4Z 24 D2, d2 40S ribosomal protein S22-A 4932
12 4U4Y 24 D2, d2 40S ribosomal protein S22-A 4932
13 4U4N 24 D2, d2 40S ribosomal protein S22-A 4932
14 4U55 24 D2, d2 40S ribosomal protein S22-A 4932
15 5DAT 24 D2 40S ribosomal protein S22-A 4932
16 5DAT 80 d2 40S ribosomal protein S22-A 4932
17 5I4L 24 D2, d2 40S ribosomal protein S22-A 4932
18 4U51 24 D2, d2 40S ribosomal protein S22-A 4932
19 6HHQ 70 X, d2 40S ribosomal protein S22-A 4932
20 5OBM 68 D2, d2 40S ribosomal protein S22-A 4932
21 4U53 24 D2, d2 40S ribosomal protein S22-A 4932
22 5ON6 72 X, d2 40S ribosomal protein S22-A 4932
23 4U50 24 D2, d2 40S ribosomal protein S22-A 4932
24 5NDV 68 D2, d2 40S ribosomal protein S22-A 4932
25 5LYB 24 D2, d2 40S ribosomal protein S22-A 4932
26 4U56 24 D2, d2 40S ribosomal protein S22-A 4932
27 5TGA 24 D2, d2 40S ribosomal protein S22-A 4932
28 5MEI 71 X, d2 40S ribosomal protein S22-A 4932
29 5FCJ 24 D2, d2 40S ribosomal protein S22-A 4932
30 4U4O 24 D2, d2 40S ribosomal protein S22-A 4932
31 5DGV 24 D2, d2 40S ribosomal protein S22-A 4932
32 5DGE 24 D2, d2 40S ribosomal protein S22-A 4932
33 5NDW 17 D2, d2 40S ribosomal protein S22-A 4932
34 5NDG 24 D2, d2 40S ribosomal protein S22-A 4932
35 5FCI 24 D2, d2 40S ribosomal protein S22-A 4932
36 5DC3 24 D2, d2 40S ribosomal protein S22-A 4932
37 5DGF 24 D2, d2 40S ribosomal protein S22-A 4932
38 5TGM 24 D2, d2 40S ribosomal protein S22-A 4932
39 4V7R 16 AO, CO 40S ribosomal protein S22-A 4932
40 5VYC 16 W1, W2, W3, W4, W5, W6 40S ribosomal protein S15a 9606
41 4KZZ 23 W 40S Ribosomal Protein S15A 9986
42 4KZX 23 W 40S ribosomal protein S15A 9986
43 4KZY 23 W 40S Ribosomal Protein S15A 9986
44 6UZ7 70 W 40S ribosomal protein S22 28985
45 6T83 24 Wb, x 40S ribosomal protein S22-A 4932
46 6T7T 24 SW 40S ribosomal protein S22-A 4932
47 6T7I 24 SW 40S ribosomal protein S22-A 4932
48 6T4Q 23 SW 40S ribosomal protein S22-A 4932
49 6SGC 24 X1 Ribosomal protein S15a 9986
50 6S47 68 BX 40S ribosomal protein S22-A TRSSVLADALNAINNAEKTGKRQVLIRPSSKVIIKFLQVMQKHGYIGEFEYIDDHRSGK IVVQLNGRLNKCGVISPRFNVKIGDIEKWTANLLPARQFGYVILTTSAGIMDHEEARRKH VSGKILGFVY 4932
51 6RXT 41 Cm 40S ribosomal protein S22-like protein 209285
52 6RXU 45 Cm 40S ribosomal protein S22-like protein 209285
53 6RXV 45 Cm 40S ribosomal protein S22-like protein 209285
54 6RXX 26 Cm 40S ribosomal protein S22-like protein 209285
55 6RXY 40 Cm 40S ribosomal protein S22-like protein 209285
56 6RXZ 44 Cm 40S ribosomal protein S22-like protein 209285
57 6P5I 24 X uS8 9986
58 6P5J 24 X uS8 9986
59 6P5K 70 X uS8 9986
60 6P5N 70 X uS8 9986
61 6P4G 24 X uS8 9986
62 6P4H 25 X uS8 9986
63 6OM7 29 SW 40S ribosomal protein S15a 9606
64 6OLZ 69 BW 40S ribosomal protein S15a 9606
65 6OM0 29 SW 40S ribosomal protein S15a 9606
66 6OLE 29 SW 40S ribosomal protein S15a 9606
67 6OLF 29 SW 40S ribosomal protein S15a 9606
68 6OLG 72 BW 40S ribosomal protein S15a 9606
69 6OLI 29 SW 40S ribosomal protein S15a 9606
70 6OKK 11 K 40S ribosomal protein S15A 5833
71 6RBD 15 W 40S ribosomal protein S22-A 4932
72 6RBE 15 W 40S ribosomal protein S22-A 4932
73 6R7Q 82 TT Ribosomal protein S15a 9986
74 6R6G 50 TT Ribosomal protein S15a 9986
75 6R6P 66 TT Ribosomal protein S15a 9986
76 6R5Q 74 TT Ribosomal protein S15a 9986
77 6QZP 76 SW 40S ribosomal protein S15a 9606
78 6Q8Y 27 b 40S ribosomal protein S22-A 4932
79 6I7O 41 b, bb 40S ribosomal protein S22-A 4932
80 6IP5 75 3M 40S ribosomal protein S15a 9606
81 6IP6 74 3M 40S ribosomal protein S15a 9606
82 6IP8 74 3M 40S ribosomal protein S15a 9606
83 6MTB 73 WW 40S ribosomal protein S15a 9986
84 6MTC 72 WW 40S ribosomal protein S15a 9986
85 6MTD 74 WW uS8 9986
86 6MTE 73 WW uS8 9986
87 6HCQ 27 X2 Ribosomal protein S15a 9986
88 6HCJ 27 X2 Ribosomal protein S15a 9986
89 6HCM 24 X1 Ribosomal protein S15a 9986
90 6HCF 24 X1 Ribosomal protein S15a 9986
91 6GZ3 33 BW Ribosomal protein S15a 9986
92 6GZ4 36 BW ribosomal protein uS8 9986
93 6GZ5 33 BW ribosomal protein uS8 9986
94 6GSM 26 W 40S ribosomal protein S22 28985
95 6GSN 40 W 40S ribosomal protein S22 28985
96 6GQV 70 AM 40S ribosomal protein S22-A 4932
97 6GQ1 70 AM 40S ribosomal protein S22-A 4932
98 6GQB 70 AM 40S ribosomal protein S22-A 4932
99 6D9J 72 XX uS8 9986
100 6D90 73 XX uS8 9986
101 6G5H 14 W 40S ribosomal protein S15a 9606
102 6G5I 24 W 40S ribosomal protein S15a 9606
103 6G4S 19 W 40S ribosomal protein S15a 9606
104 6G4W 16 W 40S ribosomal protein S15a 9606
105 6G51 15 W 40S ribosomal protein S15a 9606
106 6G53 15 W 40S ribosomal protein S15a 9606
107 6G18 25 W 40S ribosomal protein S15a 9606
108 6FYX 26 W 40S ribosomal protein S22 28985
109 6FYY 26 W 40S ribosomal protein S22 28985
110 6FEC 29 a 40S ribosomal protein S15a 9606
111 6FAI 33 W 40S ribosomal protein S22-A 4932
112 6EML 24 b 40S ribosomal protein S22-A 4932
113 6EK0 76 SW 40S ribosomal protein S15a 9606
114 6AZ1 10 J ribosomal protein S8 5661
115 5OQL 45 w 40S ribosomal protein S22-like protein 209285
116 5OPT 22 e 40S ribosomal protein S15a, putative 5693
117 5WLC 13 LE rpS22_uS8 4932
118 5XYI 24 W Ribosomal protein S15a 5722
119 5XXU 24 W Ribosomal protein uS8 5811
120 5OA3 27 W 40S ribosomal protein S15a 9606
121 5WYJ 47 SX 40S ribosomal protein S22-A 4932
122 5WYK 43 SX 40S ribosomal protein S22-A 4932
123 5TZS 14 E rpS22_uS8 4932
124 5MC6 29 b 40S ribosomal protein S22-A 4932
125 5M1J 30 W2 40S ribosomal protein S22-A 4932
126 5LZS 73 WW uS8 9986
127 5LZT 74 WW uS8 9986
128 5LZU 73 WW uS8 9986
129 5LZV 74 WW uS8 9986
130 5LZW 74 WW uS8 9986
131 5LZX 74 WW uS8 9986
132 5LZY 72 WW uS8 9986
133 5LZZ 74 WW uS8 9986
134 5T2A 65 AJ uS8 5661
135 5T2C 57 AP 40S ribosomal protein S15a 9606
136 5LL6 14 b 40S ribosomal protein S22-A 4932
137 5LKS 75 SW 40S ribosomal protein S15a 9606
138 5K0Y 23 a ribosomal protein uS8 9986
139 5JUO 72 TB uS8 (yeast S22) 4932
140 5JUP 72 TB uS8 (yeast S22) 4932
141 5JUS 72 TB uS8 (yeast S22) 4932
142 5JUT 72 TB uS8 (yeast S22) 4932
143 5JUU 72 TB uS8 (yeast S22) 4932
144 5JPQ 32 z uS8 209285
145 5IT7 70 W 40S ribosomal protein S22 28985
146 5IT9 23 W Ribosomal protein uS8 28985
147 5FLX 24 W 40S RIBOSOMAL PROTEIN S15A 9986
148 3JBN 7 K 40S ribosomal protein uS8 5833
149 3JBO 29 K 40S ribosomal protein uS8 5833
150 3JBP 7 K 40S ribosomal protein uS8 5833
151 3JAP 26 W uS8 28985
152 3JAQ 26 W uS8 28985
153 3JAM 24 W uS8 28985
154 3JAN 66 SW Ribosomal protein uS8 SEE REMARK 999 9986
155 3JAJ 67 SW Ribosomal protein uS8 SEE REMARK 999 9986
156 3JAG 74 WW uS8 9986
157 3JAH 74 WW uS8 9986
158 3JAI 74 WW uS8 9986
159 5A2Q 25 W RIBOSOMAL PROTEIN US8 9606
160 4UG0 77 SW 40S RIBOSOMAL PROTEIN S15A 9606
161 5AJ0 72 BW 40S ribosomal protein S15a 9606
162 4UER 18 H US8 4934
163 4D61 24 W 40S RIBOSOMAL PROTEIN S15A 9986
164 4D5L 24 W 40S RIBOSOMAL PROTEIN US8 9986
165 4V3P 27 SH Ribosomal protein S15 4565
166 3J81 24 W uS8 28985
167 3J80 14 W uS8 28985
168 3J7P 72 SW Ribosomal protein uS8 9823
169 3J7R 73 SW Ribosomal protein uS8 9823
170 4UJC 73 CW 40S RIBOSOMAL PROTEIN US8 9986
171 4UJD 73 CW 40S RIBOSOMAL PROTEIN US8 9986
172 3J7A 11 K 40S ribosomal protein uS8 5833
173 3J77 68 22 40S ribosomal protein S22 4932
174 3J78 68 22 40S ribosomal protein S22 4932
175 3J6X 69 22 40S ribosomal protein S22 4932
176 3J6Y 69 22 40S ribosomal protein S22 4932
177 4UJE 27 BW 40S RIBOSOMAL PROTEIN S15A 9986
178 4V92 25 BW US8 28985
179 4V7E 24 BW 40S ribosomal protein S8 4565
180 4V8Y 31 AW 40S RIBOSOMAL PROTEIN S22-A 4932
181 4V8Z 31 AW 40S RIBOSOMAL PROTEIN S22-A 4932
182 4V6W 32 AW 40S ribosomal protein S15Aa 7227
183 4V6X 32 AW 40S ribosomal protein S15a 9606
184 4V8M 18 AJ 40S RIBOSOMAL PROTEIN S15A, PUTATIVE 185431
185 4V6I 9 AH 40S ribosomal protein rpS22 (S8p) 4932
186 4V7H 7 AH 40S ribosomal protein S22(A) 5541
187 4V5Z 15 Ah 40S Ribosomal protein S15ae 9612
188 4V4B 8 AH 40S ribosomal protein S22 4932