6RXV

Cryo-EM structure of the 90S pre-ribosome (Kre33-Noc4) from Chaetomium thermophilum, state B2


Sequence Similarity Clusters for the Entities in PDB 6RXV

Entity #1 | Chains: UA
Periodic tryptophan protein 2-like protein protein, length: 904 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13487
95 % 3 7 13830
90 % 3 7 13638
70 % 3 7 12925
50 % 3 11 7683
40 % 3 11 7383
30 % 3 11 6945
Entity #10 | Chains: UM
Utp13 protein, length: 912 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13931
95 % 3 7 13558
90 % 3 7 13360
70 % 3 7 12662
50 % 3 7 11575
40 % 3 7 10869
30 % 3 7 10040
Entity #11 | Chains: UN
Utp14 protein, length: 938 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13840
95 % 3 7 13205
90 % 3 7 13002
70 % 3 7 12112
50 % 3 7 11278
40 % 3 7 10390
30 % 3 7 9792
Entity #12 | Chains: UO
Utp15 protein, length: 557 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13688
95 % 3 7 13058
90 % 3 7 12740
70 % 3 7 12243
50 % 3 7 11062
40 % 3 7 10492
30 % 3 9 8041
Entity #13 | Chains: UQ
Utp17 protein, length: 960 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13687
95 % 3 7 13057
90 % 3 7 12877
70 % 3 7 12242
50 % 3 7 11171
40 % 3 7 10491
30 % 3 7 9702
Entity #14 | Chains: UR
Utp18 protein, length: 618 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13140
95 % 3 7 13081
90 % 3 7 12901
70 % 3 7 12266
50 % 3 7 11196
40 % 3 7 10508
30 % 3 11 6770
Entity #15 | Chains: UU
Utp21 protein, length: 1049 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13436
95 % 3 7 13720
90 % 3 7 13529
70 % 3 7 12811
50 % 3 7 11716
40 % 3 7 11012
30 % 3 7 10170
Entity #16 | Chains: UX
Utp24 protein, length: 193 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 8 12615
95 % 3 8 11944
90 % 3 8 11803
70 % 3 8 11270
50 % 3 12 6695
40 % 3 12 6472
30 % 3 12 6143
Entity #17 | Chains: UZ
Utp30 protein, length: 391 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13932
95 % 3 7 13559
90 % 3 7 13361
70 % 3 7 12663
50 % 3 7 11576
40 % 3 7 10870
30 % 3 7 10041
Entity #18 | Chains: CA,CB
Nop1 protein, length: 313 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 5132
95 % 3 7 6131
90 % 3 7 6027
70 % 3 7 5936
50 % 3 11 3645
40 % 3 11 3610
30 % 3 11 3529
Entity #19 | Chains: CC
Nop56 protein, length: 523 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 14148
95 % 3 7 13945
90 % 3 7 13758
70 % 3 7 13039
50 % 3 11 7466
40 % 3 14 5886
30 % 3 14 5414
Entity #2 | Chains: UB
Utp2 protein, length: 907 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13924
95 % 3 7 13549
90 % 3 7 13346
70 % 3 7 12652
50 % 3 7 11561
40 % 3 7 10857
30 % 3 7 10028
Entity #20 | Chains: CD
Nop58 protein, length: 582 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13972
95 % 3 7 13633
90 % 3 7 13442
70 % 3 7 12735
50 % 3 7 11080
40 % 3 7 10935
30 % 3 7 10102
Entity #21 | Chains: CE,CF
Snu13 protein, length: 127 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 5360
95 % 3 7 6442
90 % 3 7 6446
70 % 3 7 6331
50 % 12 34 1418
40 % 13 35 1406
30 % 12 34 1495
Entity #22 | Chains: CG
Rrp9 protein, length: 630 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13963
95 % 3 7 13501
90 % 3 7 13297
70 % 3 7 12343
50 % 3 7 11514
40 % 3 7 10805
30 % 3 7 9982
Entity #23 | Chains: CH
RNA 3'-terminal phosphate cyclase-like protein protein, length: 411 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13888
95 % 3 7 13502
90 % 3 7 13333
70 % 3 7 12603
50 % 3 7 11515
40 % 3 7 10806
30 % 3 7 9983
Entity #24 | Chains: CI
Bms1 protein, length: 1163 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13889
95 % 3 7 13503
90 % 3 7 13298
70 % 3 7 12604
50 % 3 7 11516
40 % 3 11 7415
30 % 3 11 6969
Entity #25 | Chains: CJ
Imp3 protein, length: 183 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 8 10561
95 % 3 8 12839
90 % 3 8 11211
70 % 3 8 10761
50 % 3 12 7285
40 % 3 12 7010
30 % 3 12 6593
Entity #26 | Chains: CK
Imp4 protein, length: 297 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 8 11646
95 % 3 8 12513
90 % 3 8 12333
70 % 3 8 11749
50 % 3 11 7712
40 % 3 11 7412
30 % 3 11 6967
Entity #27 | Chains: CL
Mpp10 protein, length: 785 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13418
95 % 3 7 13669
90 % 3 7 13480
70 % 3 7 12765
50 % 3 7 11668
40 % 3 7 10964
30 % 3 7 10129
Entity #28 | Chains: CM
Sof1 protein, length: 446 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13890
95 % 3 7 13504
90 % 3 7 13299
70 % 3 7 12605
50 % 3 7 11517
40 % 3 9 8634
30 % 3 9 8098
Entity #29 | Chains: CN,CO
Emg1 protein, length: 252 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 5560
95 % 3 7 6474
90 % 3 7 6485
70 % 8 17 2487
50 % 8 17 2483
40 % 8 17 2483
30 % 8 17 2487
Entity #3 | Chains: UC
Utp3 protein, length: 648 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 14123
95 % 3 7 13903
90 % 3 7 13714
70 % 3 7 13000
50 % 3 7 11879
40 % 3 7 11154
30 % 3 7 10293
Entity #30 | Chains: CP
KRR1 small subunit processome component protein, length: 322 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 8 9122
95 % 3 8 9672
90 % 3 8 9580
70 % 3 11 7097
50 % 3 11 6488
40 % 3 11 6281
30 % 3 11 5989
Entity #31 | Chains: CQ
Pre-rRNA-processing protein PNO1 protein, length: 259 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13770
95 % 3 7 13227
90 % 3 7 13019
70 % 3 7 12373
50 % 3 7 11304
40 % 3 7 10603
30 % 3 7 9807
Entity #32 | Chains: CR,CS
Kre33 protein, length: 1073 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 8 4672
95 % 3 8 5362
90 % 3 8 5389
70 % 3 8 5331
50 % 3 8 5165
40 % 3 8 5193
30 % 3 8 4987
Entity #33 | Chains: CT
Fcf2 protein, length: 203 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13043
95 % 3 7 12983
90 % 3 7 12804
70 % 3 7 12169
50 % 3 7 11026
40 % 3 7 10355
30 % 3 7 9604
Entity #34 | Chains: Ca
40S ribosomal protein S1 protein, length: 255 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 5 18635
95 % 3 5 19009
90 % 3 5 17779
70 % 51 91 463
50 % 53 97 468
40 % 65 161 337
30 % 65 161 355
Entity #35 | Chains: Cb
40S ribosomal protein S4 protein, length: 264 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 5 21026
95 % 2 5 17982
90 % 2 5 18964
70 % 63 181 260
50 % 65 191 252
40 % 65 195 258
30 % 69 204 254
Entity #36 | Chains: Cc
40S ribosomal protein s5-like protein protein, length: 212 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13384
95 % 3 7 13228
90 % 3 7 13020
70 % 16 101 614
50 % 67 201 232
40 % 67 201 244
30 % 67 201 258
Entity #37 | Chains: Cd
40S ribosomal protein S6 protein, length: 239 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 5 20787
95 % 2 5 18945
90 % 2 5 18583
70 % 15 91 691
50 % 64 182 294
40 % 64 187 288
30 % 64 187 307
Entity #38 | Chains: Ce
40S ribosomal protein S7 protein, length: 203 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13801
95 % 3 7 13082
90 % 3 7 13092
70 % 3 7 12436
50 % 64 188 270
40 % 64 188 284
30 % 66 191 283
Entity #39 | Chains: Cf
40S ribosomal protein S8 protein, length: 202 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 5 20268
95 % 2 5 17872
90 % 2 5 18582
70 % 50 93 458
50 % 65 190 256
40 % 65 194 260
30 % 65 194 275
Entity #4 | Chains: UD
Utp4 protein, length: 884 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 4 8 9997
95 % 4 8 10444
90 % 4 8 10358
70 % 4 8 10034
50 % 4 8 9352
40 % 4 8 8922
30 % 4 8 8337
Entity #40 | Chains: Cg
40S ribosomal protein s9-like protein protein, length: 190 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13722
95 % 3 7 13518
90 % 3 7 12929
70 % 65 185 250
50 % 67 200 233
40 % 71 208 233
30 % 71 208 246
Entity #41 | Chains: Ch
40S ribosomal protein S13-like protein protein, length: 151 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13800
95 % 3 7 13296
90 % 3 7 13091
70 % 65 194 240
50 % 67 197 243
40 % 71 205 237
30 % 71 206 249
Entity #42 | Chains: Ci
40S ribosomal protein S14-like protein protein, length: 150 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13190
95 % 3 7 13204
90 % 15 81 762
70 % 67 198 224
50 % 67 199 237
40 % 67 199 247
30 % 67 199 260
Entity #43 | Chains: Cj
40S ribosomal protein S16-like protein protein, length: 143 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13416
95 % 3 7 13398
90 % 3 7 13183
70 % 3 7 12717
50 % 65 190 251
40 % 69 198 251
30 % 69 199 262
Entity #44 | Chains: Ck
40S ribosomal protein S11-like protein protein, length: 161 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 5 20620
95 % 2 5 18650
90 % 2 5 18496
70 % 51 95 448
50 % 66 197 242
40 % 66 197 253
30 % 66 197 266
Entity #45 | Chains: Cm
40S ribosomal protein S22-like protein protein, length: 130 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13802
95 % 3 7 13297
90 % 3 7 13093
70 % 66 201 232
50 % 73 212 221
40 % 74 214 227
30 % 74 214 238
Entity #46 | Chains: Cn
40S ribosomal protein s23-like protein protein, length: 145 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13360
95 % 3 7 13583
90 % 3 7 13386
70 % 67 204 214
50 % 71 214 219
40 % 71 214 228
30 % 71 214 239
Entity #47 | Chains: Co
40S ribosomal protein S24 protein, length: 136 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 5 18981
95 % 2 5 18010
90 % 2 5 18548
70 % 50 95 451
50 % 63 192 263
40 % 63 192 276
30 % 63 192 291
Entity #48 | Chains: Cp
40S ribosomal protein S28-like protein protein, length: 68 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13693
95 % 3 7 13091
90 % 3 7 13325
70 % 65 191 246
50 % 71 202 229
40 % 71 203 240
30 % 71 203 253
Entity #49 | Chains: CU
Faf1 protein, length: 311 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 14016
95 % 3 7 13709
90 % 3 7 13033
70 % 3 7 12391
50 % 3 7 11314
40 % 3 7 10616
30 % 3 7 9890
Entity #5 | Chains: UF
Utp6 protein, length: 414 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13141
95 % 3 7 13087
90 % 3 7 12902
70 % 3 7 12261
50 % 3 7 11190
40 % 3 7 10865
30 % 3 7 9715
Entity #50 | Chains: C1
35S ribosomal RNA rna, length: 2352 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
Entity #51 | Chains: C2
U3 snoRNA rna, length: 230 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
Entity #52 | Chains: UV
U3 small nucleolar RNA-associated protein 22 protein, length: 1171 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 4 31496
95 % 1 4 22891
90 % 1 4 22201
70 % 1 4 23566
50 % 1 4 20700
40 % 1 4 18795
30 % 1 4 16963
Entity #53 | Chains: CV
Rrp7 protein, length: 322 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 4 26372
95 % 1 4 26820
90 % 1 4 25928
70 % 1 4 23567
50 % 1 4 20701
40 % 1 4 18928
30 % 1 4 16964
Entity #54 | Chains: CW
Ribosome biogenesis protein ENP2 protein, length: 668 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 4 29533
95 % 2 4 23891
90 % 2 4 23164
70 % 2 4 21208
50 % 2 4 18756
40 % 2 4 17220
30 % 2 4 15532
Entity #55 | Chains: UT
Utp20 protein, length: 2612 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 4 31495
95 % 2 4 26818
90 % 2 4 25926
70 % 2 4 23565
50 % 2 4 20699
40 % 2 4 18926
30 % 2 4 16962
Entity #56 | Chains: UH
Utp8 protein, length: 930 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 6 17707
95 % 3 6 14923
90 % 3 6 15785
70 % 3 6 14829
50 % 3 6 12652
40 % 3 6 11812
30 % 3 6 10875
Entity #57 | Chains: UE,UI
Utp5 protein, length: 410 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 6 6213
95 % 3 6 8024
90 % 3 6 7986
70 % 3 6 7770
50 % 3 6 7307
40 % 3 6 7033
30 % 3 6 6616
Entity #58 | Chains: US
Noc4 protein, length: 549 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 6 15657
95 % 3 6 16271
90 % 3 6 15998
70 % 3 6 15779
50 % 3 6 13571
40 % 3 6 13228
30 % 3 6 12085
Entity #59 | Chains: Cl
Rps18 protein, length: 156 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 6 15656
95 % 3 6 16270
90 % 3 6 15997
70 % 65 183 254
50 % 67 192 248
40 % 71 202 241
30 % 71 202 255
Entity #6 | Chains: UG
Utp7 protein, length: 558 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 14144
95 % 3 7 13940
90 % 3 7 13753
70 % 3 7 12767
50 % 3 7 11670
40 % 3 9 8388
30 % 3 9 7851
Entity #60 | Chains: CX
Enp1 protein, length: 480 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 6 17640
95 % 3 6 15916
90 % 3 6 15666
70 % 3 6 14713
50 % 3 6 13303
40 % 3 6 12386
30 % 4 15 5228
Entity #61 | Chains: CY
U3 small nucleolar ribonucleoprotein protein lcp5-like protein protein, length: 381 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 3 36372
95 % 2 3 28708
90 % 2 3 27642
70 % 2 3 25019
50 % 2 3 21934
40 % 2 3 20058
30 % 2 3 17966
Entity #62 | Chains: CZ
Bfr2 protein, length: 609 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 4 25834
95 % 2 4 26120
90 % 2 4 25287
70 % 2 4 23011
50 % 2 4 20264
40 % 2 4 18540
30 % 2 4 16644
Entity #63 | Chains: UP
Utp16 protein, length: 364 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 6 16196
95 % 3 6 15741
90 % 3 6 15401
70 % 3 6 15679
50 % 3 6 14144
40 % 3 6 13145
30 % 3 6 12013
Entity #7 | Chains: UJ
UTP10 protein, length: 1802 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 8 11947
95 % 3 8 11185
90 % 3 8 11077
70 % 3 8 10647
50 % 3 8 9860
40 % 3 8 9399
30 % 3 8 8733
Entity #8 | Chains: UK
U3 small nucleolar RNA-associated protein 11 protein, length: 270 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13744
95 % 3 7 13163
90 % 3 7 12966
70 % 3 7 12331
50 % 3 7 11252
40 % 3 7 10569
30 % 3 7 9776
Entity #9 | Chains: UL
Utp12 protein, length: 962 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 7 13743
95 % 3 7 13162
90 % 3 7 12965
70 % 3 7 12330
50 % 3 7 11901
40 % 3 11 7203
30 % 3 11 6771

Instructions

In the table for each entity, view a list of similar sequences by selecting the link associated with the percentage cutoff.



View more detailed documentation on the redundancy reduction and sequence clustering procedure used by RCSB PDB.

You can also use the structure comparison tool to compare any 2 given structures


ACTION - (A) Select for download / view details OR (B) Select two chains for comparison
Rank PDB ID Entity ID Chains Description Details Taxonomy EC Number
1 4V88 24 AW, CW 40S ribosomal protein S22-A 4932
2 4U4R 24 D2, d2 40S ribosomal protein S22-A 4932
3 4U3U 24 D2, d2 40S ribosomal protein S22-A 4932
4 5TBW 71 X, d2 40S ribosomal protein S22-A 4932
5 4U3M 24 D2, d2 40S ribosomal protein S22-A 4932
6 4U3N 24 D2, d2 40S ribosomal protein S22-A 4932
7 4U52 24 D2, d2 40S ribosomal protein S22-A 4932
8 4U4Q 24 D2, d2 40S ribosomal protein S22-A 4932
9 4U6F 24 D2, d2 40S ribosomal protein S22-A 4932
10 4U4U 24 D2, d2 40S ribosomal protein S22-A 4932
11 4U4Z 24 D2, d2 40S ribosomal protein S22-A 4932
12 4U4Y 24 D2, d2 40S ribosomal protein S22-A 4932
13 4U4N 24 D2, d2 40S ribosomal protein S22-A 4932
14 4U55 24 D2, d2 40S ribosomal protein S22-A 4932
15 5DAT 24 D2 40S ribosomal protein S22-A 4932
16 5DAT 80 d2 40S ribosomal protein S22-A 4932
17 5I4L 24 D2, d2 40S ribosomal protein S22-A 4932
18 4U51 24 D2, d2 40S ribosomal protein S22-A 4932
19 6HHQ 70 X, d2 40S ribosomal protein S22-A 4932
20 5OBM 68 D2, d2 40S ribosomal protein S22-A 4932
21 4U53 24 D2, d2 40S ribosomal protein S22-A 4932
22 5ON6 72 X, d2 40S ribosomal protein S22-A 4932
23 4U50 24 D2, d2 40S ribosomal protein S22-A 4932
24 5NDV 68 D2, d2 40S ribosomal protein S22-A 4932
25 5LYB 24 D2, d2 40S ribosomal protein S22-A 4932
26 4U56 24 D2, d2 40S ribosomal protein S22-A 4932
27 5TGA 24 D2, d2 40S ribosomal protein S22-A 4932
28 5MEI 71 X, d2 40S ribosomal protein S22-A 4932
29 5FCJ 24 D2, d2 40S ribosomal protein S22-A 4932
30 4U4O 24 D2, d2 40S ribosomal protein S22-A 4932
31 5DGV 24 D2, d2 40S ribosomal protein S22-A 4932
32 5DGE 24 D2, d2 40S ribosomal protein S22-A 4932
33 5NDW 17 D2, d2 40S ribosomal protein S22-A 4932
34 5NDG 24 D2, d2 40S ribosomal protein S22-A 4932
35 5FCI 24 D2, d2 40S ribosomal protein S22-A 4932
36 5DC3 24 D2, d2 40S ribosomal protein S22-A 4932
37 5DGF 24 D2, d2 40S ribosomal protein S22-A 4932
38 5TGM 24 D2, d2 40S ribosomal protein S22-A 4932
39 4V7R 16 AO, CO 40S ribosomal protein S22-A 4932
40 5VYC 16 W1, W2, W3, W4, W5, W6 40S ribosomal protein S15a 9606
41 4KZZ 23 W 40S Ribosomal Protein S15A 9986
42 4KZX 23 W 40S ribosomal protein S15A 9986
43 4KZY 23 W 40S Ribosomal Protein S15A 9986
44 6YAL 23 Y 40S ribosomal protein uS8 9986
45 6YAM 23 Y 40S ribosomal protein uS8 9986
46 6YAN 22 Y Ribosomal protein S15a 9986
47 6W2S 15 X uS8 9986
48 6W2T 14 X uS8 9986
49 6Y7C 22 W 40S ribosomal protein S22-A 4932
50 6Y57 71 SW 40S ribosomal protein S15a 9606
51 6Y2L 71 SW 40S ribosomal protein S15a 9606
52 6Y0G 72 SW 40S ribosomal protein S15a 9606
53 6TNU 26 b 40S ribosomal protein S22-A 4932
54 6UZ7 70 W 40S ribosomal protein S22 28985
55 6TB3 26 b 40S ribosomal protein S22-A 4932
56 6T83 24 Wb, x 40S ribosomal protein S22-A 4932
57 6T7T 26 SW 40S ribosomal protein S22-A 4932
58 6T7I 24 SW 40S ribosomal protein S22-A 4932
59 6T4Q 23 SW 40S ribosomal protein S22-A 4932
60 6SV4 41 b, bb, bc 40S ribosomal protein S22-A 4932
61 6SNT 24 W 40S ribosomal protein S22-A 4932
62 6SGC 24 X1 Ribosomal protein S15a 9986
63 6S47 68 BX 40S ribosomal protein S22-A TRSSVLADALNAINNAEKTGKRQVLIRPSSKVIIKFLQVMQKHGYIGEFEYIDDHRSGK IVVQLNGRLNKCGVISPRFNVKIGDIEKWTANLLPARQFGYVILTTSAGIMDHEEARRKH VSGKILGFVY 4932
64 6RXT 41 Cm 40S ribosomal protein S22-like protein 209285
65 6RXU 45 Cm 40S ribosomal protein S22-like protein 209285
66 6RXV 45 Cm 40S ribosomal protein S22-like protein 209285
67 6RXX 26 Cm 40S ribosomal protein S22-like protein 209285
68 6RXY 40 Cm 40S ribosomal protein S22-like protein 209285
69 6RXZ 44 Cm 40S ribosomal protein S22-like protein 209285
70 6P5I 24 X uS8 9986
71 6P5J 24 X uS8 9986
72 6P5K 70 X uS8 9986
73 6P5N 70 X uS8 9986
74 6P4G 24 X uS8 9986
75 6P4H 25 X uS8 9986
76 6OM7 29 SW 40S ribosomal protein S15a 9606
77 6OLZ 69 BW 40S ribosomal protein S15a 9606
78 6OM0 29 SW 40S ribosomal protein S15a 9606
79 6OLE 29 SW 40S ribosomal protein S15a 9606
80 6OLF 29 SW 40S ribosomal protein S15a 9606
81 6OLG 72 BW 40S ribosomal protein S15a 9606
82 6OLI 29 SW 40S ribosomal protein S15a 9606
83 6OKK 11 K 40S ribosomal protein S15A 5833
84 6RBD 15 W 40S ribosomal protein S22-A 4932
85 6RBE 15 W 40S ribosomal protein S22-A 4932
86 6R7Q 82 TT Ribosomal protein S15a 9986
87 6R6G 50 TT Ribosomal protein S15a 9986
88 6R6P 66 TT Ribosomal protein S15a 9986
89 6R5Q 74 TT Ribosomal protein S15a 9986
90 6QZP 76 SW 40S ribosomal protein S15a 9606
91 6Q8Y 27 b 40S ribosomal protein S22-A 4932
92 6I7O 41 b, bb 40S ribosomal protein S22-A 4932
93 6IP5 75 3M 40S ribosomal protein S15a 9606
94 6IP6 74 3M 40S ribosomal protein S15a 9606
95 6IP8 74 3M 40S ribosomal protein S15a 9606
96 6MTB 73 WW 40S ribosomal protein S15a 9986
97 6MTC 72 WW 40S ribosomal protein S15a 9986
98 6MTD 74 WW uS8 9986
99 6MTE 73 WW uS8 9986
100 6HCQ 27 X2 Ribosomal protein S15a 9986
101 6HCJ 27 X2 Ribosomal protein S15a 9986
102 6HCM 24 X1 Ribosomal protein S15a 9986
103 6HCF 24 X1 Ribosomal protein S15a 9986
104 6GZ3 33 BW Ribosomal protein S15a 9986
105 6GZ4 36 BW ribosomal protein uS8 9986
106 6GZ5 33 BW ribosomal protein uS8 9986
107 6GSM 26 W 40S ribosomal protein S22 28985
108 6GSN 40 W 40S ribosomal protein S22 28985
109 6GQV 70 AM 40S ribosomal protein S22-A 4932
110 6GQ1 70 AM 40S ribosomal protein S22-A 4932
111 6GQB 70 AM 40S ribosomal protein S22-A 4932
112 6D9J 72 XX uS8 9986
113 6D90 73 XX uS8 9986
114 6G5H 14 W 40S ribosomal protein S15a 9606
115 6G5I 24 W 40S ribosomal protein S15a 9606
116 6G4S 19 W 40S ribosomal protein S15a 9606
117 6G4W 16 W 40S ribosomal protein S15a 9606
118 6G51 15 W 40S ribosomal protein S15a 9606
119 6G53 15 W 40S ribosomal protein S15a 9606
120 6G18 25 W 40S ribosomal protein S15a 9606
121 6FYX 26 W 40S ribosomal protein S22 28985
122 6FYY 26 W 40S ribosomal protein S22 28985
123 6FEC 29 a 40S ribosomal protein S15a 9606
124 6FAI 33 W 40S ribosomal protein S22-A 4932
125 6EML 24 b 40S ribosomal protein S22-A 4932
126 6EK0 76 SW 40S ribosomal protein S15a 9606
127 6AZ1 10 J ribosomal protein S8 5661
128 5OQL 45 w 40S ribosomal protein S22-like protein 209285
129 5OPT 22 e 40S ribosomal protein S15a, putative 5693
130 5WLC 13 LE rpS22_uS8 4932
131 5XYI 24 W Ribosomal protein S15a 5722
132 5XXU 24 W Ribosomal protein uS8 5811
133 5OA3 27 W 40S ribosomal protein S15a 9606
134 5WYJ 47 SX 40S ribosomal protein S22-A 4932
135 5WYK 43 SX 40S ribosomal protein S22-A 4932
136 5TZS 14 E rpS22_uS8 4932
137 5MC6 29 b 40S ribosomal protein S22-A 4932
138 5M1J 30 W2 40S ribosomal protein S22-A 4932
139 5LZS 73 WW uS8 9986
140 5LZT 74 WW uS8 9986
141 5LZU 73 WW uS8 9986
142 5LZV 74 WW uS8 9986
143 5LZW 74 WW uS8 9986
144 5LZX 74 WW uS8 9986
145 5LZY 72 WW uS8 9986
146 5LZZ 74 WW uS8 9986
147 5T2A 65 AJ uS8 5661
148 5T2C 57 AP 40S ribosomal protein S15a 9606
149 5LL6 14 b 40S ribosomal protein S22-A 4932
150 5LKS 75 SW 40S ribosomal protein S15a 9606
151 5K0Y 23 a ribosomal protein uS8 9986
152 5JUO 72 TB uS8 (yeast S22) 4932
153 5JUP 72 TB uS8 (yeast S22) 4932
154 5JUS 72 TB uS8 (yeast S22) 4932
155 5JUT 72 TB uS8 (yeast S22) 4932
156 5JUU 72 TB uS8 (yeast S22) 4932
157 5JPQ 32 z uS8 209285
158 5IT7 70 W 40S ribosomal protein S22 28985
159 5IT9 23 W Ribosomal protein uS8 28985
160 5FLX 24 W 40S RIBOSOMAL PROTEIN S15A 9986
161 3JBN 7 K 40S ribosomal protein uS8 5833
162 3JBO 29 K 40S ribosomal protein uS8 5833
163 3JBP 7 K 40S ribosomal protein uS8 5833
164 3JAP 26 W uS8 28985
165 3JAQ 26 W uS8 28985
166 3JAM 24 W uS8 28985
167 3JAN 66 SW Ribosomal protein uS8 SEE REMARK 999 9986
168 3JAJ 67 SW Ribosomal protein uS8 SEE REMARK 999 9986
169 3JAG 74 WW uS8 9986
170 3JAH 74 WW uS8 9986
171 3JAI 74 WW uS8 9986
172 5A2Q 25 W RIBOSOMAL PROTEIN US8 9606
173 4UG0 77 SW 40S RIBOSOMAL PROTEIN S15A 9606
174 5AJ0 72 BW 40S ribosomal protein S15a 9606
175 4UER 18 H US8 4934
176 4D61 24 W 40S RIBOSOMAL PROTEIN S15A 9986
177 4D5L 24 W 40S RIBOSOMAL PROTEIN US8 9986
178 4V3P 27 SH Ribosomal protein S15 4565
179 3J81 24 W uS8 28985
180 3J80 14 W uS8 28985
181 3J7P 72 SW Ribosomal protein uS8 9823
182 3J7R 73 SW Ribosomal protein uS8 9823
183 4UJC 73 CW 40S RIBOSOMAL PROTEIN US8 9986
184 4UJD 73 CW 40S RIBOSOMAL PROTEIN US8 9986
185 3J7A 11 K 40S ribosomal protein uS8 5833
186 3J77 68 22 40S ribosomal protein S22 4932
187 3J78 68 22 40S ribosomal protein S22 4932
188 3J6X 69 22 40S ribosomal protein S22 4932
189 3J6Y 69 22 40S ribosomal protein S22 4932
190 4UJE 27 BW 40S RIBOSOMAL PROTEIN S15A 9986
191 4V92 25 BW US8 28985
192 4V7E 24 BW 40S ribosomal protein S8 4565
193 4V8Y 31 AW 40S RIBOSOMAL PROTEIN S22-A 4932
194 4V8Z 31 AW 40S RIBOSOMAL PROTEIN S22-A 4932
195 4V6W 32 AW 40S ribosomal protein S15Aa 7227
196 4V6X 32 AW 40S ribosomal protein S15a 9606
197 4V8M 18 AJ 40S RIBOSOMAL PROTEIN S15A, PUTATIVE 185431
198 4V6I 9 AH 40S ribosomal protein rpS22 (S8p) 4932
199 4V7H 7 AH 40S ribosomal protein S22(A) 5541
200 4V5Z 15 Ah 40S Ribosomal protein S15ae 9612
201 4V4B 8 AH 40S ribosomal protein S22 4932