6SE6

Class2 : CENP-A nucleosome in complex with CENP-C central region


Sequence Similarity Clusters for the Entities in PDB 6SE6

Entity #1 | Chains: A,E
Histone H3-like centromeric protein A protein, length: 140 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 8 11 3509
95 % 8 14 3182
90 % 9 16 2815
70 % 8 11 4460
50 % 221 299 73
40 % 221 299 96
30 % 221 299 95
Entity #2 | Chains: B,F
Histone H4 protein, length: 103 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 200 279 20
95 % 222 304 18
90 % 229 313 20
70 % 230 312 28
50 % 230 312 66
40 % 230 312 90
30 % 230 312 92
Entity #3 | Chains: C,G
Histone H2A type 2-A protein, length: 130 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 4 6 9424
95 % 194 278 34
90 % 181 255 49
70 % 194 273 53
50 % 207 286 81
40 % 207 286 103
30 % 207 286 100
Entity #4 | Chains: D,H
Histone H2B type 1-C/E/F/G/I protein, length: 126 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 11 18 1669
95 % 153 189 80
90 % 197 274 43
70 % 205 285 49
50 % 210 292 76
40 % 210 292 99
30 % 210 292 98
Entity #5 | Chains: I
DNA (145-MER) dna, length: 145 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
Entity #6 | Chains: J
DNA (145-MER) dna, length: 145 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
Entity #7 | Chains: V
Centromere protein C protein, length: 124 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 3 37661
95 % 1 3 30006
90 % 1 3 28874
70 % 1 3 26087
50 % 1 3 22855
40 % 1 3 21265
30 % 1 3 19051

Instructions

In the table for each entity, view a list of similar sequences by selecting the link associated with the percentage cutoff.



View more detailed documentation on the redundancy reduction and sequence clustering procedure used by RCSB PDB.

You can also use the structure comparison tool to compare any 2 given structures


ACTION - (A) Select for download / view details OR (B) Select two chains for comparison
Rank PDB ID Entity ID Chains Description Details Taxonomy EC Number
1 4WNN 1 A, C, E, G Histone H2A.1 4932
2 1TZY 1 A, E Histone H2A-IV 9031
3 1KX5 5 C, G histone H2A.1 8355
4 2ARO 1 A, E Histone H2A-IV 9031
5 5B0Z 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
6 5Y0D 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
7 5Y0C 4 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
8 1S32 4 C, G histone H2A 8355
9 5AV8 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
10 1KX3 4 C, G histone H2A.1 8355
11 5AV9 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
12 5AV6 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
13 6JOU 3 C, G Histone H2A.Z 9606
14 1HQ3 1 A, E HISTONE H2A-IV 9031
15 3UTA 3 C, G Histone H2A 8355
16 6KVD 4 C, G Histone H2A.J 9606
17 5X7X 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
18 5B31 3 C Histone H2A type 1-B/E 9606 3.2.1.21 | Details
19 5B31 5 G Histone H2A.Z 9606
20 5B1L 3 C, G Histone H2A type 1 10090
21 6K1K 3 C, G Histone H2AX 9606
22 3UTB 3 C, G Histone H2A 8355
23 1M19 4 C, G Histone H2A.1 8355
24 5AVB 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
25 5AVC 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
26 5AV5 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
27 3C1B 3 C, G Histone H2A type 1 8355
28 5B1M 3 C, G Histone H2A type 1 10090
29 2NQB 4 C, G Histone H2A 7227
30 5OMX 5 C, G Histone H2A 8355
31 6JR1 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
32 5F99 3 C, G Histone H2A type 1 8355
33 5Z30 3 C, G Histone H2A.Z 9606
34 5JRG 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
35 3UT9 3 C, G Histone H2A 8355
36 5B32 3 C Histone H2A type 1-B/E 9606 3.2.1.21 | Details
37 5B32 5 G Histone H2A.Z 9606
38 4WU8 5 C, G Histone H2A type 1 8355
39 1P3I 4 C, G Histone H2A 8355
40 3MGR 3 C, G Histone H2A UNP RESIDUES 2-120 8355
41 1F66 4 C, G HISTONE H2A.Z 9606
42 3AZG 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
43 1M18 4 C, G Histone H2A.1 8355
44 5B2J 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
45 2PYO 5 C, G Histone H2A 7227
46 1P3L 4 C, G Histone H2A 8355
47 1EQZ 2 A, E PROTEIN (HISTONE H2A) SUBUNIT OF SALT-EXTRACTED HISTONE OCTAMER 9031
48 5B0Y 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
49 6JR0 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
50 2CV5 4 C, G Histone H2A.a 9606 3.2.1.21 | Details
51 5CP6 5 C, G Histone H2A 8355
52 5ZBX 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
53 5BT1 2 C Histone H2A.1 4932
54 5XF6 3 C, G Histone H2A 8355
55 3MGP 3 C, G Histone H2A UNP RESIDUES 2-120 8355
56 3MVD 3 C, G Histone H2A 8355
57 4J8U 3 C, G Histone H2A type 1 8355
58 4WU9 3 C, G Histone H2A type 1 8355
59 3REH 3 C, G Histone H2A type 1 8355
60 3AZL 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
61 6N1Z 2 B, E Histone H2A HISTONE H2A 8355
62 3AFA 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
63 5E5A 4 C, G Histone H2A 8355
64 3REJ 3 C, G Histone H2A type 1 8355
65 3AZF 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
66 5GTC 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
67 1P3P 4 C, G Histone H2A 8355
68 3AV1 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
69 1M1A 4 C, G Histone H2A.1 8355
70 5CPK 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
71 5AY8 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
72 3MNN 3 C, G Histone H2A 8355
73 1P3G 4 C, G Histone H2A 8355
74 4J8W 3 C, G Histone H2A 8355
75 1P34 4 C, G Histone H2A 8355
76 5XF3 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
77 3X1V 4 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
78 5ONG 5 C, G Histone H2A 8355
79 5ONW 5 C, G Histone H2A 8355
80 5DNM 3 C, G Histone H2A 8355
81 6K1I 3 C, G Histone H2AX Serine at position 144 is chemically phosphorylated (actual position S139) 9606
82 3MGQ 3 C, G Histone H2A UNP RESIDUES 2-120 8355
83 3WTP 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
84 3X1T 4 C, G Histone H2A 10090
85 2NZD 5 C, G histone H2A 8355
86 3A6N 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
87 5DNN 3 C, G Histone H2A 8355
88 5GT3 3 C, G Histone H2A type 1-D 9606
89 5GT0 3 C, G Histone H2A type 1-A 9606
90 3LJA 3 C, G Histone H2A 8355
91 3AZI 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
92 3TU4 3 C, G Histone H2A 8355
93 1P3O 4 C, G Histone H2A 8355
94 1KX4 4 C, G histone H2A.1 8355
95 3AZN 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
96 1P3M 4 C, G Histone H2A 8355
97 4J8V 3 C, G Histone H2A 8355
98 5B33 3 C, G Histone H2A.Z 9606
99 3X1S 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
100 3LZ0 3 C, G Histone H2A residues 2-120 8355
101 1P3F 4 C, G Histone H2A 8355
102 1P3K 4 C, G Histone H2A 8355
103 5B2I 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
104 1P3A 4 C, G Histone H2A 8355
105 3LZ1 3 C, G Histone H2A residues 2-120 8355
106 5GXQ 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
107 2F8N 7 K Histone H2A type 1 10090
108 4Z5T 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
109 5XM0 3 C, G Histone H2A type 1-B 10090
110 3AV2 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
111 3AYW 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
112 5XF5 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
113 3AZJ 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
114 3REK 3 C, G Histone H2A type1 8355
115 4KGC 3 C, G Histone H2A 8355
116 1ZLA 4 C, G Xenopus laevis-like histone H2A 263730
117 5GSU 3 C, G Histone H2A type 1-A 9606
118 5XF4 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
119 3REL 3 C, G Histone H2A 8355
120 5GSE 3 C, G, M Histone H2A type 1-B/E 9606 3.2.1.21 | Details
121 3REI 3 C, G Histone H2A type1 8355
122 1P3B 4 C, G Histone H2A 8355
123 3WKJ 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
124 4KUD 3 C, G Histone H2A.2 4932
125 3AZK 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
126 4J8X 3 C, G Histone H2A 8355
127 3LEL 3 C, G, M, Q Histone H2A 8355
128 3KUY 3 C, G Histone H2A 8355
129 4R8P 3 C, G Histone H2A 8355
130 3AZM 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
131 3X1U 4 C, G Histone H2A 10090
132 3MGS 3 C, G Histone H2A UNP RESIDUES 2-120 8355
133 3WA9 3 C, G Histone H2A.Z 9606
134 1ID3 4 C, G HISTONE H2A.1 4932
135 3C1C 3 C, G Histone H2A type 1 8355
136 3AZH 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
137 5B40 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
138 3WAA 3 C, G Histone H2A.V 9606
139 5CPI 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
140 4JJN 3 C, G Histone H2A.2 4932
141 3W99 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
142 3AZE 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
143 3W96 3 C, G Histone H2A type 1-B/E UNP residues 11-130 9606 3.2.1.21 | Details
144 6OM3 3 C, G, O, S Histone H2A 8355
145 5XM1 3 C, G Histone H2A type 1-B 10090
146 6K1J 3 C, G Histone H2AX 9606
147 5CPJ 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
148 5B24 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
149 2HIO 1 A PROTEIN (HISTONE H2A) 9031
150 4QLC 5 C, G Histone H2A 7227
151 4LD9 3 C, G Histone H2A 8355
152 3O62 3 C, G Histone H2A type 1 8355
153 6KXV 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
154 4XUJ 3 C, G Histone H2A UNP residues 2-126 8355
155 3W97 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
156 4YM5 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
157 4YM6 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
158 2FJ7 5 C, G histone H2A 8355
159 3W98 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
160 4ZUX 3 C, G, M, Q Histone H2A type 1 8355
161 3AN2 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
162 6VYP 3 C, G, c, g Histone H2A type 1 8355
163 3B6F 5 C, G Histone H2A 8355
164 5OY7 4 C, G, K, O, S, W, a, e Histone H2A 8355
165 3B6G 5 C, G Histone H2A 8355
166 5NL0 3 C, G, M Histone H2A type 1 The core histones in the uploaded coordinates are those from X. laevis while those in the crystal are human. The reason for the discrepancy is that the structure was solved using pdb 3UT9 as a molecular replacement template (because it had the same 601L DNA sequence and therefore was the closest high-res structure available). 8355
167 3KXB 3 C, G Histone H2A 8355
168 5HQ2 3 G Histone H2A 8355
169 6HKT 3 0, 2, C, G, M, Q, W, c, g, m, q, w Histone H2A type 1-B/E THE 3 N-TERMINAL RESIDUES (GSH) COME FROM THE EXPRESSION TAG 9606 3.2.1.21 | Details
170 5OXV 3 C, G, M, Q Histone H2A 8355
171 1ZBB 5 C, G, c, g Histone H2A.1 8355
172 7JO9 3 C, G Histone H2A type 1 9606
173 7JOA 3 C, G Histone H2A type 1 9606
174 6XJD 3 C, G Histone H2A type 1 9606
175 6X59 3 C, G Histone H2A type 1 9606
176 6X5A 3 C, G Histone H2A type 1 9606
177 6X0N 3 C, G, c, g Histone H2A 8355
178 6WZ5 3 C, G Histone H2A 8355
179 6WZ9 3 C, G Histone H2A 8355
180 7C0M 3 C, G, c, g Histone H2A type 1-B/E 9606 3.2.1.21 | Details
181 6YOV 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
182 6LTJ 3 C, G Histone H2A type 1 8355
183 6VEN 3 C, G Histone H2A type 1 8355
184 6V92 25 c, g Histone H2A type 1-B/E 9606 3.2.1.21 | Details
185 6TEM 3 C, G Histone H2A 8355
186 6TDA 3 C, G Histone H2A 8355
187 6UXW 3 T, X Histone H2A type 1 8355
188 6T9L 3 C, G Histone H2A 8355
189 6T90 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
190 6T93 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
191 6T79 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
192 6T7A 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
193 6T7B 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
194 6T7C 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
195 6T7D 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
196 6UPH 3 C, G Histone H2A 28985
197 6UPK 3 C Histone H2A 9606
198 6UPL 3 C, K Histone H2A 9606
199 6L49 3 C, G, M, Q, U, Y Histone H2A type 1-B/E 9606 3.2.1.21 | Details
200 6L4A 3 C, G, M, Q, U, Y Histone H2A type 1-B/E 9606 3.2.1.21 | Details
201 6KW4 3 O, S Histone H2A 8355
202 6KW5 17 O, T Histone H2A 8355
203 6KW3 3 O, S Histone H2A 8355
204 6SEG 3 C, G Histone H2A type 2-A 9606
205 6SE0 3 C Histone H2A type 2-A 9606
206 6SE0 5 G Histone H2A type 2-A 9606
207 6SE6 3 C, G Histone H2A type 2-A 9606
208 6SEE 3 C, G Histone H2A type 2-A 9606
209 6SEF 3 C, G Histone H2A type 2-A 9606
210 6PWV 6 I, M Histone H2A type 1 8355
211 6PWW 6 I, M Histone H2A type 1 8355
212 6PWX 4 I, M Histone H2A type 1 8355
213 6PWE 3 C, G Histone H2A 7227
214 6PWF 3 C, G Histone H2A 7227
215 6KIU 3 C, G Histone H2A 8355
216 6KIV 3 C, G Histone H2A 8355
217 6KIW 3 C, G Histone H2A 8355
218 6KIX 3 C, G Histone H2A 8355
219 6KIZ 3 C, G Histone H2A 8355
220 6S01 3 C, G Histone H2A 8355
221 6RYU 3 C, G Histone H2A type 1 8355
222 6PA7 3 C, G Histone H2A type 1 8355
223 6RYR 3 C, G Histone H2A type 1 8355
224 6K1P 3 C, G Histone H2A 8355
225 6RNY 3 C, G Histone H2A type 1 9606
226 6JYL 3 C, G Histone H2A 8355
227 6R8Y 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
228 6R8Z 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
229 6R90 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
230 6R91 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
231 6R92 6 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
232 6R93 5 C, G Histone H2A type 1-B/E GSHMSGRGKQGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLPNIQAVLLPKKTESHHKAKGK 9606 3.2.1.21 | Details
233 6R94 5 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
234 6R1U 3 C, G Histone H2A 8355
235 6R25 6 C, G Histone H2A 8355
236 6O96 3 C, G Histone H2A 8355
237 6R0C 3 C, G Histone H2A type 1 9606
238 6O1D 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
239 6J99 3 C, G Histone H2A 8355
240 6NQA 4 C, G Histone H2A type 1 8355
241 6NOG 3 C, G Histone H2A type 1 8355
242 6NN6 3 C, G Histone H2A type 1 8355
243 6J4W 21 c, g Histone H2A type 1-B/E 9606 3.2.1.21 | Details
244 6J4X 21 c, g Histone H2A type 1-B/E 9606 3.2.1.21 | Details
245 6J4Y 21 c, g Histone H2A type 1-B/E 9606 3.2.1.21 | Details
246 6J4Z 20 c, g Histone H2A type 1-B/E 9606 3.2.1.21 | Details
247 6J50 20 c, g Histone H2A type 1-B/E 9606 3.2.1.21 | Details
248 6J51 21 c, g Histone H2A type 1-B/E 9606 3.2.1.21 | Details
249 6NJ9 2 C, G Histone H2A type 1 8355
250 6NE3 3 C, G Histone H2A type 1 8355
251 6I84 2 Q, V Histone H2A type 1 8355
252 6IRO 4 C, G Histone H2A 8355
253 6IR9 21 c, g Histone H2A type 1-B/E 9606 3.2.1.21 | Details
254 6INQ 18 c, g Histone H2A type 1-B/E 9606 3.2.1.21 | Details
255 6HTS 7 K, O Histone H2A type 1-B/E 9606 3.2.1.21 | Details
256 6E0C 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
257 6E0P 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
258 6DZT 3 C, G Histone H2A 7227
259 6A5O 18 c, g Histone H2A type 1-B/E 9606 3.2.1.21 | Details
260 6A5P 18 c, g Histone H2A type 1-B/E 9606 3.2.1.21 | Details
261 6A5R 18 c, g Histone H2A type 1-B/E 9606 3.2.1.21 | Details
262 6A5T 18 c, g Histone H2A type 1-B/E 9606 3.2.1.21 | Details
263 6A5U 18 c, g Histone H2A, Histone H2A type 1-B/E 9606 3.2.1.21 | Details
264 6A5L 18 c, g Histone H2A type 1-B/E 9606 3.2.1.21 | Details
265 6GEN 4 E, F Histone H2A.1 4932
266 6GEJ 4 E, F Histone H2A.1 4932
267 6G0L 3 C Histone H2A type 1 8355
268 6G0L 5 G Histone H2A type 1 8355
269 6FTX 3 C, G Histone H2A type 1 8355
270 6FML 11 O, S Histone H2A type 1 9606
271 5Z3L 3 C, G Histone H2A 8355
272 5Z3O 3 C, G Histone H2A 8355
273 5Z3U 4 C, G Histone H2A 8355
274 5Z3V 4 C, G Histone H2A 8355
275 6C0W 3 C, G Histone H2A 9606
276 6BUZ 3 C, G Histone H2A 9606 3.2.1.21 | Details
277 6ESF 3 C, G Histone H2A 8355
278 6ESG 3 C, G Histone H2A 8355
279 6ESH 3 C, G Histone H2A 8355
280 6ESI 3 C, G Histone H2A 8355
281 5O9G 3 C, G Histone H2A 8355
282 5X0X 3 C, G Histone H2A 8355
283 5X0Y 3 C, G Histone H2A 8355
284 5KGF 3 C, G Histone H2A type 1 Isopeptide amide crosslink between K15 of H2A and G76 of ubiquitin 9606
285 2RVQ 1 C Histone H2A type 1-B/E 9606 3.2.1.21 | Details
286 3C9K 1 A, E Histone H2A-IV 9031