6SE6

Class2 : CENP-A nucleosome in complex with CENP-C central region


Sequence Similarity Clusters for the Entities in PDB 6SE6

Entity #1 | Chains: A,E
Histone H3-like centromeric protein A protein, length: 140 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 8 11 3842
95 % 8 14 3307
90 % 9 16 2922
70 % 8 11 4641
50 % 241 319 63
40 % 241 319 83
30 % 241 319 91
Entity #2 | Chains: B,F
Histone H4 protein, length: 103 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 221 300 9
95 % 243 325 17
90 % 250 334 18
70 % 251 333 25
50 % 251 333 58
40 % 251 333 77
30 % 251 333 81
Entity #3 | Chains: C,G
Histone H2A type 2-A protein, length: 130 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 5 7 6122
95 % 216 300 18
90 % 199 273 44
70 % 212 291 38
50 % 225 304 69
40 % 225 304 88
30 % 225 304 97
Entity #4 | Chains: D,H
Histone H2B type 1-C/E/F/G/I protein, length: 126 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 12 19 1605
95 % 169 205 75
90 % 218 295 25
70 % 226 306 31
50 % 231 313 67
40 % 231 313 86
30 % 231 313 94
Entity #5 | Chains: I
DNA (145-MER) dna, length: 145 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
Entity #6 | Chains: J
DNA (145-MER) dna, length: 145 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
Entity #7 | Chains: V
Centromere protein C protein, length: 124 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 3 36825
95 % 1 3 30394
90 % 1 3 29239
70 % 1 3 26344
50 % 1 3 25020
40 % 1 3 22794
30 % 1 3 18885

Instructions

In the table for each entity, view a list of similar sequences by selecting the link associated with the percentage cutoff.



View more detailed documentation on the redundancy reduction and sequence clustering procedure used by RCSB PDB.

You can also use the structure comparison tool to compare any 2 given structures


ACTION - (A) Select for download / view details OR (B) Select two chains for comparison
Rank PDB ID Entity ID Chains Description Details Taxonomy EC Number
1 4WNN 1 A, C, E, G Histone H2A.1 4932
2 1TZY 1 A, E Histone H2A-IV 9031
3 1KX5 5 C, G histone H2A.1 8355
4 2ARO 1 A, E Histone H2A-IV 9031
5 5B0Z 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
6 5Y0D 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
7 5Y0C 4 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
8 1S32 4 C, G histone H2A 8355
9 5AV8 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
10 1KX3 4 C, G histone H2A.1 8355
11 5AV9 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
12 5AV6 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
13 6JOU 3 C, G Histone H2A.Z 9606
14 1HQ3 1 A, E HISTONE H2A-IV 9031
15 3UTA 3 C, G Histone H2A 8355
16 6KVD 4 C, G Histone H2A.J 9606
17 5X7X 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
18 5B31 3 C Histone H2A type 1-B/E 9606 3.2.1.21 | Details
19 5B31 5 G Histone H2A.Z 9606
20 5B1L 3 C, G Histone H2A type 1 10090
21 6K1K 3 C, G Histone H2AX 9606
22 3UTB 3 C, G Histone H2A 8355
23 1M19 4 C, G Histone H2A.1 8355
24 5AVB 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
25 5AVC 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
26 5AV5 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
27 3C1B 3 C, G Histone H2A type 1 8355
28 5B1M 3 C, G Histone H2A type 1 10090
29 2NQB 4 C, G Histone H2A 7227
30 5OMX 5 C, G Histone H2A 8355
31 6JR1 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
32 5F99 3 C, G Histone H2A type 1 8355
33 5Z30 3 C, G Histone H2A.Z 9606
34 5JRG 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
35 3UT9 3 C, G Histone H2A 8355
36 5B32 3 C Histone H2A type 1-B/E 9606 3.2.1.21 | Details
37 5B32 5 G Histone H2A.Z 9606
38 4WU8 5 C, G Histone H2A type 1 8355
39 1P3I 4 C, G Histone H2A 8355
40 3MGR 3 C, G Histone H2A UNP RESIDUES 2-120 8355
41 1F66 4 C, G HISTONE H2A.Z 9606
42 3AZG 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
43 1M18 4 C, G Histone H2A.1 8355
44 5B2J 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
45 6V2K 3 C, G Histone H2A 9606
46 2PYO 5 C, G Histone H2A 7227
47 1P3L 4 C, G Histone H2A 8355
48 1EQZ 2 A, E PROTEIN (HISTONE H2A) SUBUNIT OF SALT-EXTRACTED HISTONE OCTAMER 9031
49 5B0Y 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
50 6JR0 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
51 2CV5 4 C, G Histone H2A.a 9606 3.2.1.21 | Details
52 5CP6 5 C, G Histone H2A 8355
53 5ZBX 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
54 5BT1 2 C Histone H2A.1 4932
55 5XF6 3 C, G Histone H2A 8355
56 3MGP 3 C, G Histone H2A UNP RESIDUES 2-120 8355
57 3MVD 3 C, G Histone H2A 8355
58 4J8U 3 C, G Histone H2A type 1 8355
59 4WU9 3 C, G Histone H2A type 1 8355
60 3REH 3 C, G Histone H2A type 1 8355
61 3AZL 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
62 6N1Z 2 B, E Histone H2A HISTONE H2A 8355
63 3AFA 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
64 5E5A 4 C, G Histone H2A 8355
65 3REJ 3 C, G Histone H2A type 1 8355
66 3AZF 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
67 5GTC 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
68 1P3P 4 C, G Histone H2A 8355
69 3AV1 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
70 1M1A 4 C, G Histone H2A.1 8355
71 5CPK 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
72 5AY8 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
73 3MNN 3 C, G Histone H2A 8355
74 1P3G 4 C, G Histone H2A 8355
75 4J8W 3 C, G Histone H2A 8355
76 1P34 4 C, G Histone H2A 8355
77 5XF3 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
78 3X1V 4 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
79 5ONG 5 C, G Histone H2A 8355
80 5ONW 5 C, G Histone H2A 8355
81 5DNM 3 C, G Histone H2A 8355
82 6K1I 3 C, G Histone H2AX Serine at position 144 is chemically phosphorylated (actual position S139) 9606
83 3MGQ 3 C, G Histone H2A UNP RESIDUES 2-120 8355
84 3WTP 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
85 3X1T 4 C, G Histone H2A 10090
86 2NZD 5 C, G histone H2A 8355
87 3A6N 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
88 5DNN 3 C, G Histone H2A 8355
89 5GT3 3 C, G Histone H2A type 1-D 9606
90 5GT0 3 C, G Histone H2A type 1-A 9606
91 3LJA 3 C, G Histone H2A 8355
92 3AZI 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
93 3TU4 3 C, G Histone H2A 8355
94 1P3O 4 C, G Histone H2A 8355
95 1KX4 4 C, G histone H2A.1 8355
96 3AZN 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
97 1P3M 4 C, G Histone H2A 8355
98 4J8V 3 C, G Histone H2A 8355
99 5B33 3 C, G Histone H2A.Z 9606
100 3X1S 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
101 3LZ0 3 C, G Histone H2A residues 2-120 8355
102 1P3F 4 C, G Histone H2A 8355
103 1P3K 4 C, G Histone H2A 8355
104 5B2I 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
105 1P3A 4 C, G Histone H2A 8355
106 3LZ1 3 C, G Histone H2A residues 2-120 8355
107 5GXQ 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
108 2F8N 7 K Histone H2A type 1 10090
109 4Z5T 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
110 5XM0 3 C, G Histone H2A type 1-B 10090
111 3AV2 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
112 3AYW 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
113 5XF5 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
114 3AZJ 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
115 3REK 3 C, G Histone H2A type1 8355
116 4KGC 3 C, G Histone H2A 8355
117 1ZLA 4 C, G Xenopus laevis-like histone H2A 263730
118 5GSU 3 C, G Histone H2A type 1-A 9606
119 5XF4 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
120 3REL 3 C, G Histone H2A 8355
121 5GSE 3 C, G, M Histone H2A type 1-B/E 9606 3.2.1.21 | Details
122 3REI 3 C, G Histone H2A type1 8355
123 1P3B 4 C, G Histone H2A 8355
124 3WKJ 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
125 4KUD 3 C, G Histone H2A.2 4932
126 3AZK 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
127 4J8X 3 C, G Histone H2A 8355
128 3LEL 3 C, G, M, Q Histone H2A 8355
129 3KUY 3 C, G Histone H2A 8355
130 4R8P 3 C, G Histone H2A 8355
131 3AZM 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
132 3X1U 4 C, G Histone H2A 10090
133 3MGS 3 C, G Histone H2A UNP RESIDUES 2-120 8355
134 3WA9 3 C, G Histone H2A.Z 9606
135 1ID3 4 C, G HISTONE H2A.1 4932
136 3C1C 3 C, G Histone H2A type 1 8355
137 3AZH 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
138 5B40 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
139 3WAA 3 C, G Histone H2A.V 9606
140 5CPI 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
141 4JJN 3 C, G Histone H2A.2 4932
142 3W99 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
143 3AZE 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
144 6LA8 3 C, G, M, Q Histone H2A type 1-B/E 9606 3.2.1.21 | Details
145 3W96 3 C, G Histone H2A type 1-B/E UNP residues 11-130 9606 3.2.1.21 | Details
146 6OM3 3 C, G, O, S Histone H2A 8355
147 5XM1 3 C, G Histone H2A type 1-B 10090
148 6K1J 3 C, G Histone H2AX 9606
149 5CPJ 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
150 6LA9 3 C, G, M, Q Histone H2A type 1-B/E 9606 3.2.1.21 | Details
151 5B24 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
152 2HIO 1 A PROTEIN (HISTONE H2A) 9031
153 4QLC 5 C, G Histone H2A 7227
154 4LD9 3 C, G Histone H2A 8355
155 3O62 3 C, G Histone H2A type 1 8355
156 6M44 3 C, G, M, Q Histone H2A type 1-B/E 9606 3.2.1.21 | Details
157 6KXV 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
158 4XUJ 3 C, G Histone H2A UNP residues 2-126 8355
159 3W97 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
160 4YM5 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
161 4YM6 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
162 2FJ7 5 C, G histone H2A 8355
163 3W98 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
164 4ZUX 3 C, G, M, Q Histone H2A type 1 8355
165 6M3V 3 C, G, M, Q Histone H2A type 1-B/E 9606 3.2.1.21 | Details
166 3AN2 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
167 6VYP 3 C, G, c, g Histone H2A type 1 8355
168 3B6F 5 C, G Histone H2A 8355
169 5OY7 4 C, G, K, O, S, W, a, e Histone H2A 8355
170 3B6G 5 C, G Histone H2A 8355
171 5NL0 3 C, G, M Histone H2A type 1 The core histones in the uploaded coordinates are those from X. laevis while those in the crystal are human. The reason for the discrepancy is that the structure was solved using pdb 3UT9 as a molecular replacement template (because it had the same 601L DNA sequence and therefore was the closest high-res structure available). 8355
172 3KXB 3 C, G Histone H2A 8355
173 5HQ2 3 G Histone H2A 8355
174 6HKT 3 0, 2, C, G, M, Q, W, c, g, m, q, w Histone H2A type 1-B/E THE 3 N-TERMINAL RESIDUES (GSH) COME FROM THE EXPRESSION TAG 9606 3.2.1.21 | Details
175 5OXV 3 C, G, M, Q Histone H2A 8355
176 1ZBB 5 C, G, c, g Histone H2A.1 8355
177 7K63 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
178 7K5X 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
179 7K5Y 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
180 7K60 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
181 7K61 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
182 7CRO 3 C, G Histone H2A 8355
183 7CRP 3 C, G Histone H2A 8355
184 7CRQ 3 C, G Histone H2A 8355
185 7CRR 3 C, G Histone H2A 8355
186 7A08 4 b, f Histone H2A type 1-C 9606
187 7JO9 3 C, G Histone H2A type 1 9606
188 7JOA 3 C, G Histone H2A type 1 9606
189 6XJD 3 C, G Histone H2A type 1 9606
190 6X59 3 C, G Histone H2A type 1 9606
191 6X5A 3 C, G Histone H2A type 1 9606
192 6X0N 3 C, G, c, g Histone H2A 8355
193 6WZ5 3 C, G Histone H2A 8355
194 6WZ9 3 C, G Histone H2A 8355
195 7C0M 3 C, G, c, g Histone H2A type 1-B/E 9606 3.2.1.21 | Details
196 6YOV 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
197 6VZ4 3 C, G Histone H2A 8355
198 6Y5D 3 C, G, O, S Histone H2A type 2-A 9606
199 6LTJ 3 C, G Histone H2A type 1 8355
200 6VEN 3 C, G Histone H2A type 1 8355
201 6V92 25 c, g Histone H2A type 1-B/E 9606 3.2.1.21 | Details
202 6TEM 3 C, G Histone H2A 8355
203 6TDA 3 C, G Histone H2A 8355
204 6UXW 3 T, X Histone H2A type 1 8355
205 6T9L 3 C, G Histone H2A 8355
206 6USJ 5 C, G, M, Q Histone H2A 9606 3.2.1.21 | Details
207 6T90 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
208 6T93 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
209 6T79 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
210 6T7A 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
211 6T7B 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
212 6T7C 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
213 6T7D 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
214 6UPH 3 C, G Histone H2A 28985
215 6UPK 3 C Histone H2A 9606
216 6UPL 3 C, K Histone H2A 9606
217 6L49 3 C, G, M, Q, U, Y Histone H2A type 1-B/E 9606 3.2.1.21 | Details
218 6L4A 3 C, G, M, Q, U, Y Histone H2A type 1-B/E 9606 3.2.1.21 | Details
219 6KW4 3 O, S Histone H2A 8355
220 6KW5 17 O, T Histone H2A 8355
221 6KW3 3 O, S Histone H2A 8355
222 6SEG 3 C, G Histone H2A type 2-A 9606
223 6SE0 3 C Histone H2A type 2-A 9606
224 6SE0 5 G Histone H2A type 2-A 9606
225 6SE6 3 C, G Histone H2A type 2-A 9606
226 6SEE 3 C, G Histone H2A type 2-A 9606
227 6SEF 3 C, G Histone H2A type 2-A 9606
228 6PWV 6 I, M Histone H2A type 1 8355
229 6PWW 6 I, M Histone H2A type 1 8355
230 6PWX 4 I, M Histone H2A type 1 8355
231 6PWE 3 C, G Histone H2A 7227
232 6PWF 3 C, G Histone H2A 7227
233 6KIU 3 C, G Histone H2A 8355
234 6KIV 3 C, G Histone H2A 8355
235 6KIW 3 C, G Histone H2A 8355
236 6KIX 3 C, G Histone H2A 8355
237 6KIZ 3 C, G Histone H2A 8355
238 6S01 3 C, G Histone H2A 8355
239 6RYU 3 C, G Histone H2A type 1 8355
240 6PA7 3 C, G Histone H2A type 1 8355
241 6RYR 3 C, G Histone H2A type 1 8355
242 6K1P 3 C, G Histone H2A 8355
243 6RNY 3 C, G Histone H2A type 1 9606
244 6JYL 3 C, G Histone H2A 8355
245 6R8Y 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
246 6R8Z 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
247 6R90 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
248 6R91 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
249 6R92 6 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
250 6R93 5 C, G Histone H2A type 1-B/E GSHMSGRGKQGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLPNIQAVLLPKKTESHHKAKGK 9606 3.2.1.21 | Details
251 6R94 5 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
252 6R1U 3 C, G Histone H2A 8355
253 6R25 6 C, G Histone H2A 8355
254 6O96 3 C, G Histone H2A 8355
255 6R0C 3 C, G Histone H2A type 1 9606
256 6O1D 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
257 6J99 3 C, G Histone H2A 8355
258 6NQA 4 C, G Histone H2A type 1 8355
259 6NOG 3 C, G Histone H2A type 1 8355
260 6NN6 3 C, G Histone H2A type 1 8355
261 6J4W 21 c, g Histone H2A type 1-B/E 9606 3.2.1.21 | Details
262 6J4X 21 c, g Histone H2A type 1-B/E 9606 3.2.1.21 | Details
263 6J4Y 21 c, g Histone H2A type 1-B/E 9606 3.2.1.21 | Details
264 6J4Z 20 c, g Histone H2A type 1-B/E 9606 3.2.1.21 | Details
265 6J50 20 c, g Histone H2A type 1-B/E 9606 3.2.1.21 | Details
266 6J51 21 c, g Histone H2A type 1-B/E 9606 3.2.1.21 | Details
267 6NJ9 2 C, G Histone H2A type 1 8355
268 6NE3 3 C, G Histone H2A type 1 8355
269 6I84 2 Q, V Histone H2A type 1 8355
270 6IRO 4 C, G Histone H2A 8355
271 6IR9 21 c, g Histone H2A type 1-B/E 9606 3.2.1.21 | Details
272 6INQ 18 c, g Histone H2A type 1-B/E 9606 3.2.1.21 | Details
273 6HTS 7 K, O Histone H2A type 1-B/E 9606 3.2.1.21 | Details
274 6E0C 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
275 6E0P 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
276 6DZT 3 C, G Histone H2A 7227
277 6A5O 18 c, g Histone H2A type 1-B/E 9606 3.2.1.21 | Details
278 6A5P 18 c, g Histone H2A type 1-B/E 9606 3.2.1.21 | Details
279 6A5R 18 c, g Histone H2A type 1-B/E 9606 3.2.1.21 | Details
280 6A5T 18 c, g Histone H2A type 1-B/E 9606 3.2.1.21 | Details
281 6A5U 18 c, g Histone H2A, Histone H2A type 1-B/E 9606 3.2.1.21 | Details
282 6A5L 18 c, g Histone H2A type 1-B/E 9606 3.2.1.21 | Details
283 6GEN 4 E, F Histone H2A.1 4932
284 6GEJ 4 E, F Histone H2A.1 4932
285 6G0L 3 C Histone H2A type 1 8355
286 6G0L 5 G Histone H2A type 1 8355
287 6FTX 3 C, G Histone H2A type 1 8355
288 6FML 11 O, S Histone H2A type 1 9606
289 5Z3L 3 C, G Histone H2A 8355
290 5Z3O 3 C, G Histone H2A 8355
291 5Z3U 4 C, G Histone H2A 8355
292 5Z3V 4 C, G Histone H2A 8355
293 6C0W 3 C, G Histone H2A 9606
294 6BUZ 3 C, G Histone H2A 9606 3.2.1.21 | Details
295 6ESF 3 C, G Histone H2A 8355
296 6ESG 3 C, G Histone H2A 8355
297 6ESH 3 C, G Histone H2A 8355
298 6ESI 3 C, G Histone H2A 8355
299 5O9G 3 C, G Histone H2A 8355
300 5X0X 3 C, G Histone H2A 8355
301 5X0Y 3 C, G Histone H2A 8355
302 5KGF 3 C, G Histone H2A type 1 Isopeptide amide crosslink between K15 of H2A and G76 of ubiquitin 9606
303 2RVQ 1 C Histone H2A type 1-B/E 9606 3.2.1.21 | Details
304 3C9K 1 A, E Histone H2A-IV 9031