Sequence Similarity Clusters for the Entities in PDB 6SE6

Entity #1 | Chains: A,E
Histone H3-like centromeric protein A protein, length: 140 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 7 10 3563
95 % 7 13 3112
90 % 8 15 2763
70 % 7 10 4437
50 % 187 259 87
40 % 187 259 101
30 % 187 259 100
Entity #2 | Chains: B,F
Histone H4 protein, length: 103 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 168 241 37
95 % 187 263 34
90 % 194 272 37
70 % 195 271 46
50 % 195 271 82
40 % 195 271 96
30 % 195 271 93
Entity #3 | Chains: C,G
Histone H2A type 2-A protein, length: 130 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 4 6 8604
95 % 165 243 46
90 % 158 226 69
70 % 161 232 77
50 % 161 232 100
40 % 161 232 116
30 % 161 232 120
Entity #4 | Chains: D,H
Histone H2B type 1-C/E/F/G/I protein, length: 126 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 6 13 2290
95 % 130 166 110
90 % 164 235 66
70 % 172 246 65
50 % 177 253 92
40 % 177 253 105
30 % 177 253 106
Entity #5 | Chains: I
DNA (145-MER) dna, length: 145 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
Entity #6 | Chains: J
DNA (145-MER) dna, length: 145 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
Entity #7 | Chains: V
Centromere protein C protein, length: 124 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 3 33470
95 % 1 3 30289
90 % 1 3 29159
70 % 1 3 26293
50 % 1 3 21338
40 % 1 3 19627
30 % 1 3 18942

Instructions

In the table for each entity, view a list of similar sequences by selecting the link associated with the percentage cutoff.



View more detailed documentation on the redundancy reduction and sequence clustering procedure used by RCSB PDB.

You can also use the structure comparison tool to compare any 2 given structures


ACTION - (A) Select for download / view details OR (B) Select two chains for comparison
Rank PDB ID Entity ID Chains Description Details Taxonomy EC Number
1 1TZY 1 A, E Histone H2A-IV 9031
2 1KX5 5 C, G histone H2A.1 8355
3 2ARO 1 A, E Histone H2A-IV 9031
4 5B0Z 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
5 5Y0D 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
6 5Y0C 4 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
7 1S32 4 C, G histone H2A 8355
8 5AV8 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
9 1KX3 4 C, G histone H2A.1 8355
10 5AV9 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
11 5AV6 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
12 1HQ3 1 A, E HISTONE H2A-IV 9031
13 3UTA 3 C, G Histone H2A 8355
14 5X7X 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
15 5B31 3 C Histone H2A type 1-B/E 9606 3.2.1.21 | Details
16 5B1L 3 C, G Histone H2A type 1 10090
17 3UTB 3 C, G Histone H2A 8355
18 1M19 4 C, G Histone H2A.1 8355
19 5AVB 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
20 5AVC 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
21 5AV5 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
22 3C1B 3 C, G Histone H2A type 1 8355
23 5B1M 3 C, G Histone H2A type 1 10090
24 2NQB 4 C, G Histone H2A 7227
25 5OMX 5 C, G Histone H2A 8355
26 6JR1 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
27 5F99 3 C, G Histone H2A type 1 8355
28 5JRG 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
29 3UT9 3 C, G Histone H2A 8355
30 5B32 3 C Histone H2A type 1-B/E 9606 3.2.1.21 | Details
31 4WU8 5 C, G Histone H2A type 1 8355
32 1P3I 4 C, G Histone H2A 8355
33 3MGR 3 C, G Histone H2A UNP RESIDUES 2-120 8355
34 3AZG 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
35 1M18 4 C, G Histone H2A.1 8355
36 5B2J 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
37 2PYO 5 C, G Histone H2A 7227
38 1P3L 4 C, G Histone H2A 8355
39 1EQZ 2 A, E PROTEIN (HISTONE H2A) SUBUNIT OF SALT-EXTRACTED HISTONE OCTAMER 9031
40 5B0Y 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
41 6JR0 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
42 2CV5 4 C, G Histone H2A.a 9606 3.2.1.21 | Details
43 5CP6 5 C, G Histone H2A 8355
44 5ZBX 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
45 5XF6 3 C, G Histone H2A 8355
46 3MGP 3 C, G Histone H2A UNP RESIDUES 2-120 8355
47 3MVD 3 C, G Histone H2A 8355
48 4J8U 3 C, G Histone H2A type 1 8355
49 4WU9 3 C, G Histone H2A type 1 8355
50 3REH 3 C, G Histone H2A type 1 8355
51 3AZL 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
52 6N1Z 2 B, E Histone H2A HISTONE H2A 8355
53 3AFA 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
54 5E5A 4 C, G Histone H2A 8355
55 3REJ 3 C, G Histone H2A type 1 8355
56 3AZF 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
57 5GTC 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
58 1P3P 4 C, G Histone H2A 8355
59 3AV1 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
60 1M1A 4 C, G Histone H2A.1 8355
61 5CPK 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
62 5AY8 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
63 3MNN 3 C, G Histone H2A 8355
64 1P3G 4 C, G Histone H2A 8355
65 4J8W 3 C, G Histone H2A 8355
66 1P34 4 C, G Histone H2A 8355
67 5XF3 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
68 3X1V 4 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
69 5ONG 5 C, G Histone H2A 8355
70 5ONW 5 C, G Histone H2A 8355
71 5DNM 3 C, G Histone H2A 8355
72 3MGQ 3 C, G Histone H2A UNP RESIDUES 2-120 8355
73 3WTP 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
74 3X1T 4 C, G Histone H2A 10090
75 2NZD 5 C, G histone H2A 8355
76 3A6N 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
77 5DNN 3 C, G Histone H2A 8355
78 5GT3 3 C, G Histone H2A type 1-D 9606
79 5GT0 3 C, G Histone H2A type 1-A 9606
80 3LJA 3 C, G Histone H2A 8355
81 3AZI 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
82 3TU4 3 C, G Histone H2A 8355
83 1P3O 4 C, G Histone H2A 8355
84 1KX4 4 C, G histone H2A.1 8355
85 3AZN 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
86 1P3M 4 C, G Histone H2A 8355
87 4J8V 3 C, G Histone H2A 8355
88 3X1S 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
89 3LZ0 3 C, G Histone H2A residues 2-120 8355
90 1P3F 4 C, G Histone H2A 8355
91 1P3K 4 C, G Histone H2A 8355
92 5B2I 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
93 1P3A 4 C, G Histone H2A 8355
94 3LZ1 3 C, G Histone H2A residues 2-120 8355
95 5GXQ 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
96 4Z5T 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
97 5XM0 3 C, G Histone H2A type 1-B 10090
98 3AV2 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
99 3AYW 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
100 5XF5 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
101 3AZJ 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
102 3REK 3 C, G Histone H2A type1 8355
103 4KGC 3 C, G Histone H2A 8355
104 1ZLA 4 C, G Xenopus laevis-like histone H2A 263730
105 5GSU 3 C, G Histone H2A type 1-A 9606
106 5XF4 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
107 3REL 3 C, G Histone H2A 8355
108 5GSE 3 C, G, M Histone H2A type 1-B/E 9606 3.2.1.21 | Details
109 3REI 3 C, G Histone H2A type1 8355
110 1P3B 4 C, G Histone H2A 8355
111 3WKJ 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
112 3AZK 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
113 4J8X 3 C, G Histone H2A 8355
114 3LEL 3 C, G, M, Q Histone H2A 8355
115 3KUY 3 C, G Histone H2A 8355
116 4R8P 3 C, G Histone H2A 8355
117 3AZM 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
118 3X1U 4 C, G Histone H2A 10090
119 3MGS 3 C, G Histone H2A UNP RESIDUES 2-120 8355
120 3C1C 3 C, G Histone H2A type 1 8355
121 3AZH 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
122 5B40 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
123 5CPI 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
124 3W99 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
125 3AZE 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
126 3W96 3 C, G Histone H2A type 1-B/E UNP residues 11-130 9606 3.2.1.21 | Details
127 6OM3 3 C, G, O, S Histone H2A 8355
128 5XM1 3 C, G Histone H2A type 1-B 10090
129 5CPJ 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
130 5B24 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
131 2HIO 1 A PROTEIN (HISTONE H2A) 9031
132 4QLC 5 C, G Histone H2A 7227
133 4LD9 3 C, G Histone H2A 8355
134 3O62 3 C, G Histone H2A type 1 8355
135 4XUJ 3 C, G Histone H2A UNP residues 2-126 8355
136 3W97 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
137 4YM5 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
138 4YM6 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
139 2FJ7 5 C, G histone H2A 8355
140 3W98 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
141 4ZUX 3 C, G, M, Q Histone H2A type 1 8355
142 3AN2 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
143 3B6F 5 C, G Histone H2A 8355
144 5OY7 4 C, G, K, O, S, W, a, e Histone H2A 8355
145 3B6G 5 C, G Histone H2A 8355
146 5NL0 3 C, G, M Histone H2A type 1 The core histones in the uploaded coordinates are those from X. laevis while those in the crystal are human. The reason for the discrepancy is that the structure was solved using pdb 3UT9 as a molecular replacement template (because it had the same 601L DNA sequence and therefore was the closest high-res structure available). 8355
147 3KXB 3 C, G Histone H2A 8355
148 5HQ2 3 G Histone H2A 8355
149 6HKT 3 0, 2, C, G, M, Q, W, c, g, m, q, w Histone H2A type 1-B/E THE 3 N-TERMINAL RESIDUES (GSH) COME FROM THE EXPRESSION TAG 9606 3.2.1.21 | Details
150 5OXV 3 C, G, M, Q Histone H2A 8355
151 1ZBB 5 C, G, c, g Histone H2A.1 8355
152 6UPK 3 C Histone H2A 9606
153 6UPL 3 C, K Histone H2A 9606
154 6L49 3 C, G, M, Q, U, Y Histone H2A type 1-B/E 9606 3.2.1.21 | Details
155 6L4A 3 C, G, M, Q, U, Y Histone H2A type 1-B/E 9606 3.2.1.21 | Details
156 6KW4 3 O, S Histone H2A 8355
157 6KW3 3 O, S Histone H2A 8355
158 6SEG 3 C, G Histone H2A type 2-A 9606
159 6SE0 3 C Histone H2A type 2-A 9606
160 6SE0 5 G Histone H2A type 2-A 9606
161 6SE6 3 C, G Histone H2A type 2-A 9606
162 6SEE 3 C, G Histone H2A type 2-A 9606
163 6SEF 3 C, G Histone H2A type 2-A 9606
164 6PWE 3 C, G Histone H2A 7227
165 6PWF 3 C, G Histone H2A 7227
166 6KIU 3 C, G Histone H2A 8355
167 6KIV 3 C, G Histone H2A 8355
168 6KIW 3 C, G Histone H2A 8355
169 6KIX 3 C, G Histone H2A 8355
170 6KIZ 3 C, G Histone H2A 8355
171 6K1P 3 C, G Histone H2A 8355
172 6RNY 3 C, G Histone H2A type 1 9606
173 6JYL 3 C, G Histone H2A 8355
174 6R8Y 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
175 6R8Z 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
176 6R90 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
177 6R91 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
178 6R92 6 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
179 6R93 5 C, G Histone H2A type 1-B/E GSHMSGRGKQGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLPNIQAVLLPKKTESHHKAKGK 9606 3.2.1.21 | Details
180 6R94 5 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
181 6R1U 3 C, G Histone H2A 8355
182 6R25 6 C, G Histone H2A 8355
183 6O96 3 C, G Histone H2A 8355
184 6R0C 3 C, G Histone H2A type 1 9606
185 6O1D 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
186 6J99 3 C, G Histone H2A 8355
187 6NQA 4 C, G Histone H2A type 1 8355
188 6NOG 3 C, G Histone H2A type 1 8355
189 6NN6 3 C, G Histone H2A type 1 8355
190 6J4W 21 c, g Histone H2A type 1-B/E 9606 3.2.1.21 | Details
191 6J4X 21 c, g Histone H2A type 1-B/E 9606 3.2.1.21 | Details
192 6J4Y 21 c, g Histone H2A type 1-B/E 9606 3.2.1.21 | Details
193 6J4Z 20 c, g Histone H2A type 1-B/E 9606 3.2.1.21 | Details
194 6J50 20 c, g Histone H2A type 1-B/E 9606 3.2.1.21 | Details
195 6J51 21 c, g Histone H2A type 1-B/E 9606 3.2.1.21 | Details
196 6NJ9 2 C, G Histone H2A type 1 8355
197 6NE3 3 C, G Histone H2A type 1 8355
198 6I84 2 Q, V Histone H2A type 1 8355
199 6IRO 4 C, G Histone H2A 8355
200 6IR9 21 c, g Histone H2A type 1-B/E 9606 3.2.1.21 | Details
201 6INQ 18 c, g Histone H2A type 1-B/E 9606 3.2.1.21 | Details
202 6HTS 7 K, O Histone H2A type 1-B/E 9606 3.2.1.21 | Details
203 6E0C 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
204 6E0P 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
205 6DZT 3 C, G Histone H2A 7227
206 6A5O 18 c, g Histone H2A type 1-B/E 9606 3.2.1.21 | Details
207 6A5P 18 c, g Histone H2A type 1-B/E 9606 3.2.1.21 | Details
208 6A5R 18 c, g Histone H2A type 1-B/E 9606 3.2.1.21 | Details
209 6A5T 18 c, g Histone H2A type 1-B/E 9606 3.2.1.21 | Details
210 6A5U 18 c, g Histone H2A, Histone H2A type 1-B/E 9606 3.2.1.21 | Details
211 6A5L 18 c, g Histone H2A type 1-B/E 9606 3.2.1.21 | Details
212 6G0L 3 C Histone H2A type 1 8355
213 6G0L 5 G Histone H2A type 1 8355
214 6FTX 3 C, G Histone H2A type 1 8355
215 6FML 11 O, S Histone H2A type 1 9606
216 5Z3L 3 C, G Histone H2A 8355
217 5Z3O 3 C, G Histone H2A 8355
218 5Z3T 4 C, G Histone H2A 8355
219 5Z3U 4 C, G Histone H2A 8355
220 5Z3V 4 C, G Histone H2A 8355
221 6C0W 3 C, G Histone H2A 9606
222 6BUZ 3 C, G Histone H2A 9606 3.2.1.21 | Details
223 6ESF 3 C, G Histone H2A 8355
224 6ESG 3 C, G Histone H2A 8355
225 6ESH 3 C, G Histone H2A 8355
226 6ESI 3 C, G Histone H2A 8355
227 5O9G 3 C, G Histone H2A 8355
228 5X0X 3 C, G Histone H2A 8355
229 5X0Y 3 C, G Histone H2A 8355
230 5KGF 3 C, G Histone H2A type 1 Isopeptide amide crosslink between K15 of H2A and G76 of ubiquitin 9606
231 2RVQ 1 C Histone H2A type 1-B/E 9606 3.2.1.21 | Details
232 3C9K 1 A, E Histone H2A-IV 9031