6SE6

Class2 : CENP-A nucleosome in complex with CENP-C central region


Sequence Similarity Clusters for the Entities in PDB 6SE6

Entity #1 | Chains: A,E
Histone H3-like centromeric protein A protein, length: 140 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 8 11 3748
95 % 8 14 3221
90 % 9 16 2860
70 % 8 11 4479
50 % 240 318 65
40 % 240 318 86
30 % 240 318 94
Entity #2 | Chains: B,F
Histone H4 protein, length: 103 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 220 299 9
95 % 242 324 17
90 % 249 333 19
70 % 250 332 25
50 % 250 332 58
40 % 250 332 78
30 % 250 332 81
Entity #3 | Chains: C,G
Histone H2A type 2-A protein, length: 130 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 5 7 6007
95 % 215 299 19
90 % 198 272 45
70 % 211 290 39
50 % 224 303 69
40 % 224 303 91
30 % 224 303 97
Entity #4 | Chains: D,H
Histone H2B type 1-C/E/F/G/I protein, length: 126 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 12 19 1606
95 % 169 205 75
90 % 217 294 24
70 % 225 305 31
50 % 230 312 67
40 % 230 312 88
30 % 230 312 95
Entity #5 | Chains: I
DNA (145-MER) dna, length: 145 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
Entity #6 | Chains: J
DNA (145-MER) dna, length: 145 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
Entity #7 | Chains: V
Centromere protein C protein, length: 124 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 3 38502
95 % 1 3 30652
90 % 1 3 30153
70 % 1 3 26588
50 % 1 3 23321
40 % 1 3 21317
30 % 1 3 20315

Instructions

In the table for each entity, view a list of similar sequences by selecting the link associated with the percentage cutoff.



View more detailed documentation on the redundancy reduction and sequence clustering procedure used by RCSB PDB.

You can also use the structure comparison tool to compare any 2 given structures


ACTION - (A) Select for download / view details OR (B) Select two chains for comparison
Rank PDB ID Entity ID Chains Description Details Taxonomy EC Number
1 4WNN 1 A, C, E, G Histone H2A.1 4932
2 1TZY 1 A, E Histone H2A-IV 9031
3 1KX5 5 C, G histone H2A.1 8355
4 2ARO 1 A, E Histone H2A-IV 9031
5 5B0Z 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
6 5Y0D 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
7 5Y0C 4 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
8 1S32 4 C, G histone H2A 8355
9 5AV8 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
10 1KX3 4 C, G histone H2A.1 8355
11 5AV9 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
12 5AV6 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
13 1HQ3 1 A, E HISTONE H2A-IV 9031
14 3UTA 3 C, G Histone H2A 8355
15 6KVD 4 C, G Histone H2A.J 9606
16 5X7X 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
17 5B31 3 C Histone H2A type 1-B/E 9606 3.2.1.21 | Details
18 5B1L 3 C, G Histone H2A type 1 10090
19 6K1K 3 C, G Histone H2AX 9606
20 3UTB 3 C, G Histone H2A 8355
21 1M19 4 C, G Histone H2A.1 8355
22 5AVB 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
23 5AVC 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
24 5AV5 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
25 3C1B 3 C, G Histone H2A type 1 8355
26 5B1M 3 C, G Histone H2A type 1 10090
27 2NQB 4 C, G Histone H2A 7227
28 5OMX 5 C, G Histone H2A 8355
29 6JR1 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
30 5F99 3 C, G Histone H2A type 1 8355
31 5JRG 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
32 3UT9 3 C, G Histone H2A 8355
33 5B32 3 C Histone H2A type 1-B/E 9606 3.2.1.21 | Details
34 4WU8 5 C, G Histone H2A type 1 8355
35 1P3I 4 C, G Histone H2A 8355
36 3MGR 3 C, G Histone H2A UNP RESIDUES 2-120 8355
37 3AZG 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
38 1M18 4 C, G Histone H2A.1 8355
39 5B2J 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
40 6V2K 3 C, G Histone H2A 9606
41 2PYO 5 C, G Histone H2A 7227
42 1P3L 4 C, G Histone H2A 8355
43 1EQZ 2 A, E PROTEIN (HISTONE H2A) SUBUNIT OF SALT-EXTRACTED HISTONE OCTAMER 9031
44 5B0Y 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
45 6JR0 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
46 2CV5 4 C, G Histone H2A.a 9606 3.2.1.21 | Details
47 5CP6 5 C, G Histone H2A 8355
48 5ZBX 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
49 5BT1 2 C Histone H2A.1 4932
50 5XF6 3 C, G Histone H2A 8355
51 3MGP 3 C, G Histone H2A UNP RESIDUES 2-120 8355
52 3MVD 3 C, G Histone H2A 8355
53 4J8U 3 C, G Histone H2A type 1 8355
54 4WU9 3 C, G Histone H2A type 1 8355
55 3REH 3 C, G Histone H2A type 1 8355
56 3AZL 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
57 6N1Z 2 B, E Histone H2A HISTONE H2A 8355
58 3AFA 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
59 5E5A 4 C, G Histone H2A 8355
60 3REJ 3 C, G Histone H2A type 1 8355
61 3AZF 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
62 5GTC 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
63 1P3P 4 C, G Histone H2A 8355
64 3AV1 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
65 1M1A 4 C, G Histone H2A.1 8355
66 5CPK 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
67 5AY8 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
68 3MNN 3 C, G Histone H2A 8355
69 1P3G 4 C, G Histone H2A 8355
70 4J8W 3 C, G Histone H2A 8355
71 1P34 4 C, G Histone H2A 8355
72 5XF3 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
73 3X1V 4 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
74 5ONG 5 C, G Histone H2A 8355
75 5ONW 5 C, G Histone H2A 8355
76 5DNM 3 C, G Histone H2A 8355
77 6K1I 3 C, G Histone H2AX Serine at position 144 is chemically phosphorylated (actual position S139) 9606
78 3MGQ 3 C, G Histone H2A UNP RESIDUES 2-120 8355
79 3WTP 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
80 3X1T 4 C, G Histone H2A 10090
81 2NZD 5 C, G histone H2A 8355
82 3A6N 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
83 5DNN 3 C, G Histone H2A 8355
84 5GT3 3 C, G Histone H2A type 1-D 9606
85 5GT0 3 C, G Histone H2A type 1-A 9606
86 3LJA 3 C, G Histone H2A 8355
87 3AZI 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
88 3TU4 3 C, G Histone H2A 8355
89 1P3O 4 C, G Histone H2A 8355
90 1KX4 4 C, G histone H2A.1 8355
91 3AZN 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
92 1P3M 4 C, G Histone H2A 8355
93 4J8V 3 C, G Histone H2A 8355
94 3X1S 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
95 3LZ0 3 C, G Histone H2A residues 2-120 8355
96 1P3F 4 C, G Histone H2A 8355
97 1P3K 4 C, G Histone H2A 8355
98 5B2I 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
99 1P3A 4 C, G Histone H2A 8355
100 3LZ1 3 C, G Histone H2A residues 2-120 8355
101 5GXQ 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
102 2F8N 7 K Histone H2A type 1 10090
103 4Z5T 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
104 5XM0 3 C, G Histone H2A type 1-B 10090
105 3AV2 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
106 3AYW 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
107 5XF5 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
108 3AZJ 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
109 3REK 3 C, G Histone H2A type1 8355
110 4KGC 3 C, G Histone H2A 8355
111 1ZLA 4 C, G Xenopus laevis-like histone H2A 263730
112 5GSU 3 C, G Histone H2A type 1-A 9606
113 5XF4 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
114 3REL 3 C, G Histone H2A 8355
115 5GSE 3 C, G, M Histone H2A type 1-B/E 9606 3.2.1.21 | Details
116 3REI 3 C, G Histone H2A type1 8355
117 1P3B 4 C, G Histone H2A 8355
118 3WKJ 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
119 4KUD 3 C, G Histone H2A.2 4932
120 3AZK 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
121 4J8X 3 C, G Histone H2A 8355
122 3LEL 3 C, G, M, Q Histone H2A 8355
123 3KUY 3 C, G Histone H2A 8355
124 4R8P 3 C, G Histone H2A 8355
125 3AZM 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
126 3X1U 4 C, G Histone H2A 10090
127 3MGS 3 C, G Histone H2A UNP RESIDUES 2-120 8355
128 1ID3 4 C, G HISTONE H2A.1 4932
129 3C1C 3 C, G Histone H2A type 1 8355
130 3AZH 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
131 5B40 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
132 5CPI 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
133 4JJN 3 C, G Histone H2A.2 4932
134 3W99 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
135 3AZE 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
136 6LA8 3 C, G, M, Q Histone H2A type 1-B/E 9606 3.2.1.21 | Details
137 3W96 3 C, G Histone H2A type 1-B/E UNP residues 11-130 9606 3.2.1.21 | Details
138 6OM3 3 C, G, O, S Histone H2A 8355
139 5XM1 3 C, G Histone H2A type 1-B 10090
140 6K1J 3 C, G Histone H2AX 9606
141 5CPJ 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
142 6LA9 3 C, G, M, Q Histone H2A type 1-B/E 9606 3.2.1.21 | Details
143 5B24 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
144 2HIO 1 A PROTEIN (HISTONE H2A) 9031
145 4QLC 5 C, G Histone H2A 7227
146 4LD9 3 C, G Histone H2A 8355
147 3O62 3 C, G Histone H2A type 1 8355
148 6M44 3 C, G, M, Q Histone H2A type 1-B/E 9606 3.2.1.21 | Details
149 6KXV 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
150 4XUJ 3 C, G Histone H2A UNP residues 2-126 8355
151 3W97 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
152 4YM5 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
153 4YM6 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
154 2FJ7 5 C, G histone H2A 8355
155 3W98 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
156 4ZUX 3 C, G, M, Q Histone H2A type 1 8355
157 6M3V 3 C, G, M, Q Histone H2A type 1-B/E 9606 3.2.1.21 | Details
158 3AN2 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
159 6VYP 3 C, G, c, g Histone H2A type 1 8355
160 3B6F 5 C, G Histone H2A 8355
161 5OY7 4 C, G, K, O, S, W, a, e Histone H2A 8355
162 3B6G 5 C, G Histone H2A 8355
163 5NL0 3 C, G, M Histone H2A type 1 The core histones in the uploaded coordinates are those from X. laevis while those in the crystal are human. The reason for the discrepancy is that the structure was solved using pdb 3UT9 as a molecular replacement template (because it had the same 601L DNA sequence and therefore was the closest high-res structure available). 8355
164 3KXB 3 C, G Histone H2A 8355
165 5HQ2 3 G Histone H2A 8355
166 6HKT 3 0, 2, C, G, M, Q, W, c, g, m, q, w Histone H2A type 1-B/E THE 3 N-TERMINAL RESIDUES (GSH) COME FROM THE EXPRESSION TAG 9606 3.2.1.21 | Details
167 5OXV 3 C, G, M, Q Histone H2A 8355
168 1ZBB 5 C, G, c, g Histone H2A.1 8355
169 7K63 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
170 7K5X 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
171 7K5Y 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
172 7K60 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
173 7K61 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
174 7CRO 3 C, G Histone H2A 8355
175 7CRP 3 C, G Histone H2A 8355
176 7CRQ 3 C, G Histone H2A 8355
177 7CRR 3 C, G Histone H2A 8355
178 7A08 4 b, f Histone H2A type 1-C 9606
179 7JO9 3 C, G Histone H2A type 1 9606
180 7JOA 3 C, G Histone H2A type 1 9606
181 6XJD 3 C, G Histone H2A type 1 9606
182 6X59 3 C, G Histone H2A type 1 9606
183 6X5A 3 C, G Histone H2A type 1 9606
184 6X0N 3 C, G, c, g Histone H2A 8355
185 6WZ5 3 C, G Histone H2A 8355
186 6WZ9 3 C, G Histone H2A 8355
187 7C0M 3 C, G, c, g Histone H2A type 1-B/E 9606 3.2.1.21 | Details
188 6YOV 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
189 6Y5D 3 C, G, O, S Histone H2A type 2-A 9606
190 6LTJ 3 C, G Histone H2A type 1 8355
191 6VEN 3 C, G Histone H2A type 1 8355
192 6V92 25 c, g Histone H2A type 1-B/E 9606 3.2.1.21 | Details
193 6TEM 3 C, G Histone H2A 8355
194 6TDA 3 C, G Histone H2A 8355
195 6UXW 3 T, X Histone H2A type 1 8355
196 6T9L 3 C, G Histone H2A 8355
197 6USJ 5 C, G, M, Q Histone H2A 9606 3.2.1.21 | Details
198 6T90 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
199 6T93 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
200 6UPH 3 C, G Histone H2A 28985
201 6UPK 3 C Histone H2A 9606
202 6UPL 3 C, K Histone H2A 9606
203 6L49 3 C, G, M, Q, U, Y Histone H2A type 1-B/E 9606 3.2.1.21 | Details
204 6L4A 3 C, G, M, Q, U, Y Histone H2A type 1-B/E 9606 3.2.1.21 | Details
205 6KW4 3 O, S Histone H2A 8355
206 6KW5 17 O, T Histone H2A 8355
207 6KW3 3 O, S Histone H2A 8355
208 6SEG 3 C, G Histone H2A type 2-A 9606
209 6SE0 3 C Histone H2A type 2-A 9606
210 6SE0 5 G Histone H2A type 2-A 9606
211 6SE6 3 C, G Histone H2A type 2-A 9606
212 6SEE 3 C, G Histone H2A type 2-A 9606
213 6SEF 3 C, G Histone H2A type 2-A 9606
214 6PWV 6 I, M Histone H2A type 1 8355
215 6PWW 6 I, M Histone H2A type 1 8355
216 6PWX 4 I, M Histone H2A type 1 8355
217 6PWE 3 C, G Histone H2A 7227
218 6PWF 3 C, G Histone H2A 7227
219 6KIU 3 C, G Histone H2A 8355
220 6KIV 3 C, G Histone H2A 8355
221 6KIW 3 C, G Histone H2A 8355
222 6KIX 3 C, G Histone H2A 8355
223 6KIZ 3 C, G Histone H2A 8355
224 6S01 3 C, G Histone H2A 8355
225 6RYU 3 C, G Histone H2A type 1 8355
226 6PA7 3 C, G Histone H2A type 1 8355
227 6RYR 3 C, G Histone H2A type 1 8355
228 6K1P 3 C, G Histone H2A 8355
229 6RNY 3 C, G Histone H2A type 1 9606
230 6JYL 3 C, G Histone H2A 8355
231 6R8Y 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
232 6R8Z 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
233 6R90 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
234 6R91 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
235 6R92 6 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
236 6R93 5 C, G Histone H2A type 1-B/E GSHMSGRGKQGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLPNIQAVLLPKKTESHHKAKGK 9606 3.2.1.21 | Details
237 6R94 5 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
238 6R1U 3 C, G Histone H2A 8355
239 6R25 6 C, G Histone H2A 8355
240 6O96 3 C, G Histone H2A 8355
241 6R0C 3 C, G Histone H2A type 1 9606
242 6O1D 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
243 6J99 3 C, G Histone H2A 8355
244 6NQA 4 C, G Histone H2A type 1 8355
245 6NOG 3 C, G Histone H2A type 1 8355
246 6NN6 3 C, G Histone H2A type 1 8355
247 6J4W 21 c, g Histone H2A type 1-B/E 9606 3.2.1.21 | Details
248 6J4X 21 c, g Histone H2A type 1-B/E 9606 3.2.1.21 | Details
249 6J4Y 21 c, g Histone H2A type 1-B/E 9606 3.2.1.21 | Details
250 6J4Z 20 c, g Histone H2A type 1-B/E 9606 3.2.1.21 | Details
251 6J50 20 c, g Histone H2A type 1-B/E 9606 3.2.1.21 | Details
252 6J51 21 c, g Histone H2A type 1-B/E 9606 3.2.1.21 | Details
253 6NJ9 2 C, G Histone H2A type 1 8355
254 6NE3 3 C, G Histone H2A type 1 8355
255 6I84 2 Q, V Histone H2A type 1 8355
256 6IRO 4 C, G Histone H2A 8355
257 6IR9 21 c, g Histone H2A type 1-B/E 9606 3.2.1.21 | Details
258 6INQ 18 c, g Histone H2A type 1-B/E 9606 3.2.1.21 | Details
259 6HTS 7 K, O Histone H2A type 1-B/E 9606 3.2.1.21 | Details
260 6E0C 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
261 6E0P 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
262 6DZT 3 C, G Histone H2A 7227
263 6A5O 18 c, g Histone H2A type 1-B/E 9606 3.2.1.21 | Details
264 6A5P 18 c, g Histone H2A type 1-B/E 9606 3.2.1.21 | Details
265 6A5R 18 c, g Histone H2A type 1-B/E 9606 3.2.1.21 | Details
266 6A5T 18 c, g Histone H2A type 1-B/E 9606 3.2.1.21 | Details
267 6A5U 18 c, g Histone H2A, Histone H2A type 1-B/E 9606 3.2.1.21 | Details
268 6A5L 18 c, g Histone H2A type 1-B/E 9606 3.2.1.21 | Details
269 6GEN 4 E, F Histone H2A.1 4932
270 6GEJ 4 E, F Histone H2A.1 4932
271 6G0L 3 C Histone H2A type 1 8355
272 6G0L 5 G Histone H2A type 1 8355
273 6FTX 3 C, G Histone H2A type 1 8355
274 6FML 11 O, S Histone H2A type 1 9606
275 5Z3L 3 C, G Histone H2A 8355
276 5Z3O 3 C, G Histone H2A 8355
277 5Z3U 4 C, G Histone H2A 8355
278 5Z3V 4 C, G Histone H2A 8355
279 6C0W 3 C, G Histone H2A 9606
280 6BUZ 3 C, G Histone H2A 9606 3.2.1.21 | Details
281 6ESF 3 C, G Histone H2A 8355
282 6ESG 3 C, G Histone H2A 8355
283 6ESH 3 C, G Histone H2A 8355
284 6ESI 3 C, G Histone H2A 8355
285 5O9G 3 C, G Histone H2A 8355
286 5X0X 3 C, G Histone H2A 8355
287 5X0Y 3 C, G Histone H2A 8355
288 5KGF 3 C, G Histone H2A type 1 Isopeptide amide crosslink between K15 of H2A and G76 of ubiquitin 9606
289 2RVQ 1 C Histone H2A type 1-B/E 9606 3.2.1.21 | Details
290 3C9K 1 A, E Histone H2A-IV 9031