Sequence Similarity Clusters for the Entities in PDB 6SE6

Entity #1 | Chains: A,E
Histone H3-like centromeric protein A protein, length: 140 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 7 10 3681
95 % 7 13 3282
90 % 8 15 2830
70 % 7 10 4634
50 % 193 269 81
40 % 193 269 99
30 % 193 269 98
Entity #2 | Chains: B,F
Histone H4 protein, length: 103 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 174 251 24
95 % 193 273 33
90 % 200 282 36
70 % 201 281 46
50 % 201 281 78
40 % 201 281 96
30 % 201 281 94
Entity #3 | Chains: C,G
Histone H2A type 2-A protein, length: 130 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 4 6 8485
95 % 171 253 37
90 % 164 236 65
70 % 174 251 58
50 % 181 258 88
40 % 181 258 104
30 % 181 258 104
Entity #4 | Chains: D,H
Histone H2B type 1-C/E/F/G/I protein, length: 126 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 6 13 2309
95 % 135 171 103
90 % 170 245 63
70 % 178 256 54
50 % 178 256 90
40 % 178 256 106
30 % 178 256 107
Entity #5 | Chains: I
DNA (145-MER) dna, length: 145 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
Entity #6 | Chains: J
DNA (145-MER) dna, length: 145 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
Entity #7 | Chains: V
Centromere protein C protein, length: 124 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 3 33709
95 % 1 3 27945
90 % 1 3 29298
70 % 1 3 24592
50 % 1 3 23296
40 % 1 3 21290
30 % 1 3 17574

Instructions

In the table for each entity, view a list of similar sequences by selecting the link associated with the percentage cutoff.



View more detailed documentation on the redundancy reduction and sequence clustering procedure used by RCSB PDB.

You can also use the structure comparison tool to compare any 2 given structures


ACTION - (A) Select for download / view details OR (B) Select two chains for comparison
Rank PDB ID Entity ID Chains Description Details Taxonomy EC Number
1 4WNN 1 A, C, E, G Histone H2A.1 4932
2 1TZY 1 A, E Histone H2A-IV 9031
3 1KX5 5 C, G histone H2A.1 8355
4 2ARO 1 A, E Histone H2A-IV 9031
5 5B0Z 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
6 5Y0D 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
7 5Y0C 4 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
8 1S32 4 C, G histone H2A 8355
9 5AV8 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
10 1KX3 4 C, G histone H2A.1 8355
11 5AV9 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
12 5AV6 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
13 1HQ3 1 A, E HISTONE H2A-IV 9031
14 3UTA 3 C, G Histone H2A 8355
15 6KVD 4 C, G Histone H2A.J 9606
16 5X7X 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
17 5B31 3 C Histone H2A type 1-B/E 9606 3.2.1.21 | Details
18 5B1L 3 C, G Histone H2A type 1 10090
19 6K1K 3 C, G Histone H2AX 9606
20 3UTB 3 C, G Histone H2A 8355
21 1M19 4 C, G Histone H2A.1 8355
22 5AVB 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
23 5AVC 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
24 5AV5 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
25 3C1B 3 C, G Histone H2A type 1 8355
26 5B1M 3 C, G Histone H2A type 1 10090
27 2NQB 4 C, G Histone H2A 7227
28 5OMX 5 C, G Histone H2A 8355
29 6JR1 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
30 5F99 3 C, G Histone H2A type 1 8355
31 5JRG 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
32 3UT9 3 C, G Histone H2A 8355
33 5B32 3 C Histone H2A type 1-B/E 9606 3.2.1.21 | Details
34 4WU8 5 C, G Histone H2A type 1 8355
35 1P3I 4 C, G Histone H2A 8355
36 3MGR 3 C, G Histone H2A UNP RESIDUES 2-120 8355
37 3AZG 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
38 1M18 4 C, G Histone H2A.1 8355
39 5B2J 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
40 2PYO 5 C, G Histone H2A 7227
41 1P3L 4 C, G Histone H2A 8355
42 1EQZ 2 A, E PROTEIN (HISTONE H2A) SUBUNIT OF SALT-EXTRACTED HISTONE OCTAMER 9031
43 5B0Y 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
44 6JR0 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
45 2CV5 4 C, G Histone H2A.a 9606 3.2.1.21 | Details
46 5CP6 5 C, G Histone H2A 8355
47 5ZBX 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
48 5BT1 2 C Histone H2A.1 4932
49 5XF6 3 C, G Histone H2A 8355
50 3MGP 3 C, G Histone H2A UNP RESIDUES 2-120 8355
51 3MVD 3 C, G Histone H2A 8355
52 4J8U 3 C, G Histone H2A type 1 8355
53 4WU9 3 C, G Histone H2A type 1 8355
54 3REH 3 C, G Histone H2A type 1 8355
55 3AZL 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
56 6N1Z 2 B, E Histone H2A HISTONE H2A 8355
57 3AFA 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
58 5E5A 4 C, G Histone H2A 8355
59 3REJ 3 C, G Histone H2A type 1 8355
60 3AZF 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
61 5GTC 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
62 1P3P 4 C, G Histone H2A 8355
63 3AV1 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
64 1M1A 4 C, G Histone H2A.1 8355
65 5CPK 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
66 5AY8 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
67 3MNN 3 C, G Histone H2A 8355
68 1P3G 4 C, G Histone H2A 8355
69 4J8W 3 C, G Histone H2A 8355
70 1P34 4 C, G Histone H2A 8355
71 5XF3 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
72 3X1V 4 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
73 5ONG 5 C, G Histone H2A 8355
74 5ONW 5 C, G Histone H2A 8355
75 5DNM 3 C, G Histone H2A 8355
76 6K1I 3 C, G Histone H2AX Serine at position 144 is chemically phosphorylated (actual position S139) 9606
77 3MGQ 3 C, G Histone H2A UNP RESIDUES 2-120 8355
78 3WTP 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
79 3X1T 4 C, G Histone H2A 10090
80 2NZD 5 C, G histone H2A 8355
81 3A6N 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
82 5DNN 3 C, G Histone H2A 8355
83 5GT3 3 C, G Histone H2A type 1-D 9606
84 5GT0 3 C, G Histone H2A type 1-A 9606
85 3LJA 3 C, G Histone H2A 8355
86 3AZI 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
87 3TU4 3 C, G Histone H2A 8355
88 1P3O 4 C, G Histone H2A 8355
89 1KX4 4 C, G histone H2A.1 8355
90 3AZN 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
91 1P3M 4 C, G Histone H2A 8355
92 4J8V 3 C, G Histone H2A 8355
93 3X1S 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
94 3LZ0 3 C, G Histone H2A residues 2-120 8355
95 1P3F 4 C, G Histone H2A 8355
96 1P3K 4 C, G Histone H2A 8355
97 5B2I 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
98 1P3A 4 C, G Histone H2A 8355
99 3LZ1 3 C, G Histone H2A residues 2-120 8355
100 5GXQ 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
101 2F8N 7 K Histone H2A type 1 10090
102 4Z5T 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
103 5XM0 3 C, G Histone H2A type 1-B 10090
104 3AV2 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
105 3AYW 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
106 5XF5 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
107 3AZJ 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
108 3REK 3 C, G Histone H2A type1 8355
109 4KGC 3 C, G Histone H2A 8355
110 1ZLA 4 C, G Xenopus laevis-like histone H2A 263730
111 5GSU 3 C, G Histone H2A type 1-A 9606
112 5XF4 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
113 3REL 3 C, G Histone H2A 8355
114 5GSE 3 C, G, M Histone H2A type 1-B/E 9606 3.2.1.21 | Details
115 3REI 3 C, G Histone H2A type1 8355
116 1P3B 4 C, G Histone H2A 8355
117 3WKJ 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
118 4KUD 3 C, G Histone H2A.2 4932
119 3AZK 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
120 4J8X 3 C, G Histone H2A 8355
121 3LEL 3 C, G, M, Q Histone H2A 8355
122 3KUY 3 C, G Histone H2A 8355
123 4R8P 3 C, G Histone H2A 8355
124 3AZM 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
125 3X1U 4 C, G Histone H2A 10090
126 3MGS 3 C, G Histone H2A UNP RESIDUES 2-120 8355
127 1ID3 4 C, G HISTONE H2A.1 4932
128 3C1C 3 C, G Histone H2A type 1 8355
129 3AZH 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
130 5B40 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
131 5CPI 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
132 4JJN 3 C, G Histone H2A.2 4932
133 3W99 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
134 3AZE 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
135 3W96 3 C, G Histone H2A type 1-B/E UNP residues 11-130 9606 3.2.1.21 | Details
136 6OM3 3 C, G, O, S Histone H2A 8355
137 5XM1 3 C, G Histone H2A type 1-B 10090
138 6K1J 3 C, G Histone H2AX 9606
139 5CPJ 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
140 5B24 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
141 2HIO 1 A PROTEIN (HISTONE H2A) 9031
142 4QLC 5 C, G Histone H2A 7227
143 4LD9 3 C, G Histone H2A 8355
144 3O62 3 C, G Histone H2A type 1 8355
145 4XUJ 3 C, G Histone H2A UNP residues 2-126 8355
146 3W97 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
147 4YM5 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
148 4YM6 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
149 2FJ7 5 C, G histone H2A 8355
150 3W98 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
151 4ZUX 3 C, G, M, Q Histone H2A type 1 8355
152 3AN2 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
153 3B6F 5 C, G Histone H2A 8355
154 5OY7 4 C, G, K, O, S, W, a, e Histone H2A 8355
155 3B6G 5 C, G Histone H2A 8355
156 5NL0 3 C, G, M Histone H2A type 1 The core histones in the uploaded coordinates are those from X. laevis while those in the crystal are human. The reason for the discrepancy is that the structure was solved using pdb 3UT9 as a molecular replacement template (because it had the same 601L DNA sequence and therefore was the closest high-res structure available). 8355
157 3KXB 3 C, G Histone H2A 8355
158 5HQ2 3 G Histone H2A 8355
159 6HKT 3 0, 2, C, G, M, Q, W, c, g, m, q, w Histone H2A type 1-B/E THE 3 N-TERMINAL RESIDUES (GSH) COME FROM THE EXPRESSION TAG 9606 3.2.1.21 | Details
160 5OXV 3 C, G, M, Q Histone H2A 8355
161 1ZBB 5 C, G, c, g Histone H2A.1 8355
162 6VEN 3 C, G Histone H2A type 1 8355
163 6V92 25 c, g Histone H2A type 1-B/E 9606 3.2.1.21 | Details
164 6UPH 3 C, G Histone H2A 28985
165 6UPK 3 C Histone H2A 9606
166 6UPL 3 C, K Histone H2A 9606
167 6L49 3 C, G, M, Q, U, Y Histone H2A type 1-B/E 9606 3.2.1.21 | Details
168 6L4A 3 C, G, M, Q, U, Y Histone H2A type 1-B/E 9606 3.2.1.21 | Details
169 6KW4 3 O, S Histone H2A 8355
170 6KW3 3 O, S Histone H2A 8355
171 6SEG 3 C, G Histone H2A type 2-A 9606
172 6SE0 3 C Histone H2A type 2-A 9606
173 6SE0 5 G Histone H2A type 2-A 9606
174 6SE6 3 C, G Histone H2A type 2-A 9606
175 6SEE 3 C, G Histone H2A type 2-A 9606
176 6SEF 3 C, G Histone H2A type 2-A 9606
177 6PWV 6 I, M Histone H2A type 1 8355
178 6PWW 6 I, M Histone H2A type 1 8355
179 6PWX 4 I, M Histone H2A type 1 8355
180 6PWE 3 C, G Histone H2A 7227
181 6PWF 3 C, G Histone H2A 7227
182 6KIU 3 C, G Histone H2A 8355
183 6KIV 3 C, G Histone H2A 8355
184 6KIW 3 C, G Histone H2A 8355
185 6KIX 3 C, G Histone H2A 8355
186 6KIZ 3 C, G Histone H2A 8355
187 6S01 3 C, G Histone H2A 8355
188 6K1P 3 C, G Histone H2A 8355
189 6RNY 3 C, G Histone H2A type 1 9606
190 6JYL 3 C, G Histone H2A 8355
191 6R8Y 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
192 6R8Z 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
193 6R90 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
194 6R91 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
195 6R92 6 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
196 6R93 5 C, G Histone H2A type 1-B/E GSHMSGRGKQGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLPNIQAVLLPKKTESHHKAKGK 9606 3.2.1.21 | Details
197 6R94 5 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
198 6R1U 3 C, G Histone H2A 8355
199 6R25 6 C, G Histone H2A 8355
200 6O96 3 C, G Histone H2A 8355
201 6R0C 3 C, G Histone H2A type 1 9606
202 6O1D 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
203 6J99 3 C, G Histone H2A 8355
204 6NQA 4 C, G Histone H2A type 1 8355
205 6NOG 3 C, G Histone H2A type 1 8355
206 6NN6 3 C, G Histone H2A type 1 8355
207 6J4W 21 c, g Histone H2A type 1-B/E 9606 3.2.1.21 | Details
208 6J4X 21 c, g Histone H2A type 1-B/E 9606 3.2.1.21 | Details
209 6J4Y 21 c, g Histone H2A type 1-B/E 9606 3.2.1.21 | Details
210 6J4Z 20 c, g Histone H2A type 1-B/E 9606 3.2.1.21 | Details
211 6J50 20 c, g Histone H2A type 1-B/E 9606 3.2.1.21 | Details
212 6J51 21 c, g Histone H2A type 1-B/E 9606 3.2.1.21 | Details
213 6NJ9 2 C, G Histone H2A type 1 8355
214 6NE3 3 C, G Histone H2A type 1 8355
215 6I84 2 Q, V Histone H2A type 1 8355
216 6IRO 4 C, G Histone H2A 8355
217 6IR9 21 c, g Histone H2A type 1-B/E 9606 3.2.1.21 | Details
218 6INQ 18 c, g Histone H2A type 1-B/E 9606 3.2.1.21 | Details
219 6HTS 7 K, O Histone H2A type 1-B/E 9606 3.2.1.21 | Details
220 6E0C 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
221 6E0P 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
222 6DZT 3 C, G Histone H2A 7227
223 6A5O 18 c, g Histone H2A type 1-B/E 9606 3.2.1.21 | Details
224 6A5P 18 c, g Histone H2A type 1-B/E 9606 3.2.1.21 | Details
225 6A5R 18 c, g Histone H2A type 1-B/E 9606 3.2.1.21 | Details
226 6A5T 18 c, g Histone H2A type 1-B/E 9606 3.2.1.21 | Details
227 6A5U 18 c, g Histone H2A, Histone H2A type 1-B/E 9606 3.2.1.21 | Details
228 6A5L 18 c, g Histone H2A type 1-B/E 9606 3.2.1.21 | Details
229 6GEN 4 E, F Histone H2A.1 4932
230 6GEJ 4 E, F Histone H2A.1 4932
231 6G0L 3 C Histone H2A type 1 8355
232 6G0L 5 G Histone H2A type 1 8355
233 6FTX 3 C, G Histone H2A type 1 8355
234 6FML 11 O, S Histone H2A type 1 9606
235 5Z3L 3 C, G Histone H2A 8355
236 5Z3O 3 C, G Histone H2A 8355
237 5Z3T 4 C, G Histone H2A 8355
238 5Z3U 4 C, G Histone H2A 8355
239 5Z3V 4 C, G Histone H2A 8355
240 6C0W 3 C, G Histone H2A 9606
241 6BUZ 3 C, G Histone H2A 9606 3.2.1.21 | Details
242 6ESF 3 C, G Histone H2A 8355
243 6ESG 3 C, G Histone H2A 8355
244 6ESH 3 C, G Histone H2A 8355
245 6ESI 3 C, G Histone H2A 8355
246 5O9G 3 C, G Histone H2A 8355
247 5X0X 3 C, G Histone H2A 8355
248 5X0Y 3 C, G Histone H2A 8355
249 5KGF 3 C, G Histone H2A type 1 Isopeptide amide crosslink between K15 of H2A and G76 of ubiquitin 9606
250 2RVQ 1 C Histone H2A type 1-B/E 9606 3.2.1.21 | Details
251 3C9K 1 A, E Histone H2A-IV 9031