6SE6

Class2 : CENP-A nucleosome in complex with CENP-C central region


Sequence Similarity Clusters for the Entities in PDB 6SE6

Entity #1 | Chains: A,E
Histone H3-like centromeric protein A protein, length: 140 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 8 11 3439
95 % 8 14 3116
90 % 9 16 2743
70 % 8 11 4353
50 % 211 289 81
40 % 211 289 97
30 % 211 289 97
Entity #2 | Chains: B,F
Histone H4 protein, length: 103 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 190 269 20
95 % 212 294 26
90 % 219 303 20
70 % 220 302 34
50 % 220 302 74
40 % 220 302 91
30 % 220 302 93
Entity #3 | Chains: C,G
Histone H2A type 2-A protein, length: 130 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 4 6 9196
95 % 184 268 38
90 % 171 245 68
70 % 184 263 53
50 % 197 276 85
40 % 197 276 102
30 % 197 276 101
Entity #4 | Chains: D,H
Histone H2B type 1-C/E/F/G/I protein, length: 126 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 6 13 2490
95 % 147 183 87
90 % 187 264 45
70 % 195 275 51
50 % 200 282 83
40 % 200 282 100
30 % 200 282 100
Entity #5 | Chains: I
DNA (145-MER) dna, length: 145 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
Entity #6 | Chains: J
DNA (145-MER) dna, length: 145 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
Entity #7 | Chains: V
Centromere protein C protein, length: 124 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 3 37832
95 % 1 3 30423
90 % 1 3 29331
70 % 1 3 26400
50 % 1 3 23124
40 % 1 3 21140
30 % 1 3 18933

Instructions

In the table for each entity, view a list of similar sequences by selecting the link associated with the percentage cutoff.



View more detailed documentation on the redundancy reduction and sequence clustering procedure used by RCSB PDB.

You can also use the structure comparison tool to compare any 2 given structures


ACTION - (A) Select for download / view details OR (B) Select two chains for comparison
Rank PDB ID Entity ID Chains Description Details Taxonomy EC Number
1 4WNN 1 A, C, E, G Histone H2A.1 4932
2 1TZY 1 A, E Histone H2A-IV 9031
3 1KX5 5 C, G histone H2A.1 8355
4 2ARO 1 A, E Histone H2A-IV 9031
5 5B0Z 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
6 5Y0D 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
7 5Y0C 4 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
8 1S32 4 C, G histone H2A 8355
9 5AV8 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
10 1KX3 4 C, G histone H2A.1 8355
11 5AV9 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
12 5AV6 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
13 1HQ3 1 A, E HISTONE H2A-IV 9031
14 3UTA 3 C, G Histone H2A 8355
15 6KVD 4 C, G Histone H2A.J 9606
16 5X7X 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
17 5B31 3 C Histone H2A type 1-B/E 9606 3.2.1.21 | Details
18 5B1L 3 C, G Histone H2A type 1 10090
19 6K1K 3 C, G Histone H2AX 9606
20 3UTB 3 C, G Histone H2A 8355
21 1M19 4 C, G Histone H2A.1 8355
22 5AVB 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
23 5AVC 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
24 5AV5 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
25 3C1B 3 C, G Histone H2A type 1 8355
26 5B1M 3 C, G Histone H2A type 1 10090
27 2NQB 4 C, G Histone H2A 7227
28 5OMX 5 C, G Histone H2A 8355
29 6JR1 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
30 5F99 3 C, G Histone H2A type 1 8355
31 5JRG 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
32 3UT9 3 C, G Histone H2A 8355
33 5B32 3 C Histone H2A type 1-B/E 9606 3.2.1.21 | Details
34 4WU8 5 C, G Histone H2A type 1 8355
35 1P3I 4 C, G Histone H2A 8355
36 3MGR 3 C, G Histone H2A UNP RESIDUES 2-120 8355
37 3AZG 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
38 1M18 4 C, G Histone H2A.1 8355
39 5B2J 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
40 2PYO 5 C, G Histone H2A 7227
41 1P3L 4 C, G Histone H2A 8355
42 1EQZ 2 A, E PROTEIN (HISTONE H2A) SUBUNIT OF SALT-EXTRACTED HISTONE OCTAMER 9031
43 5B0Y 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
44 6JR0 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
45 2CV5 4 C, G Histone H2A.a 9606 3.2.1.21 | Details
46 5CP6 5 C, G Histone H2A 8355
47 5ZBX 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
48 5BT1 2 C Histone H2A.1 4932
49 5XF6 3 C, G Histone H2A 8355
50 3MGP 3 C, G Histone H2A UNP RESIDUES 2-120 8355
51 3MVD 3 C, G Histone H2A 8355
52 4J8U 3 C, G Histone H2A type 1 8355
53 4WU9 3 C, G Histone H2A type 1 8355
54 3REH 3 C, G Histone H2A type 1 8355
55 3AZL 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
56 6N1Z 2 B, E Histone H2A HISTONE H2A 8355
57 3AFA 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
58 5E5A 4 C, G Histone H2A 8355
59 3REJ 3 C, G Histone H2A type 1 8355
60 3AZF 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
61 5GTC 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
62 1P3P 4 C, G Histone H2A 8355
63 3AV1 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
64 1M1A 4 C, G Histone H2A.1 8355
65 5CPK 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
66 5AY8 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
67 3MNN 3 C, G Histone H2A 8355
68 1P3G 4 C, G Histone H2A 8355
69 4J8W 3 C, G Histone H2A 8355
70 1P34 4 C, G Histone H2A 8355
71 5XF3 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
72 3X1V 4 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
73 5ONG 5 C, G Histone H2A 8355
74 5ONW 5 C, G Histone H2A 8355
75 5DNM 3 C, G Histone H2A 8355
76 6K1I 3 C, G Histone H2AX Serine at position 144 is chemically phosphorylated (actual position S139) 9606
77 3MGQ 3 C, G Histone H2A UNP RESIDUES 2-120 8355
78 3WTP 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
79 3X1T 4 C, G Histone H2A 10090
80 2NZD 5 C, G histone H2A 8355
81 3A6N 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
82 5DNN 3 C, G Histone H2A 8355
83 5GT3 3 C, G Histone H2A type 1-D 9606
84 5GT0 3 C, G Histone H2A type 1-A 9606
85 3LJA 3 C, G Histone H2A 8355
86 3AZI 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
87 3TU4 3 C, G Histone H2A 8355
88 1P3O 4 C, G Histone H2A 8355
89 1KX4 4 C, G histone H2A.1 8355
90 3AZN 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
91 1P3M 4 C, G Histone H2A 8355
92 4J8V 3 C, G Histone H2A 8355
93 3X1S 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
94 3LZ0 3 C, G Histone H2A residues 2-120 8355
95 1P3F 4 C, G Histone H2A 8355
96 1P3K 4 C, G Histone H2A 8355
97 5B2I 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
98 1P3A 4 C, G Histone H2A 8355
99 3LZ1 3 C, G Histone H2A residues 2-120 8355
100 5GXQ 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
101 2F8N 7 K Histone H2A type 1 10090
102 4Z5T 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
103 5XM0 3 C, G Histone H2A type 1-B 10090
104 3AV2 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
105 3AYW 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
106 5XF5 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
107 3AZJ 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
108 3REK 3 C, G Histone H2A type1 8355
109 4KGC 3 C, G Histone H2A 8355
110 1ZLA 4 C, G Xenopus laevis-like histone H2A 263730
111 5GSU 3 C, G Histone H2A type 1-A 9606
112 5XF4 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
113 3REL 3 C, G Histone H2A 8355
114 5GSE 3 C, G, M Histone H2A type 1-B/E 9606 3.2.1.21 | Details
115 3REI 3 C, G Histone H2A type1 8355
116 1P3B 4 C, G Histone H2A 8355
117 3WKJ 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
118 4KUD 3 C, G Histone H2A.2 4932
119 3AZK 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
120 4J8X 3 C, G Histone H2A 8355
121 3LEL 3 C, G, M, Q Histone H2A 8355
122 3KUY 3 C, G Histone H2A 8355
123 4R8P 3 C, G Histone H2A 8355
124 3AZM 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
125 3X1U 4 C, G Histone H2A 10090
126 3MGS 3 C, G Histone H2A UNP RESIDUES 2-120 8355
127 1ID3 4 C, G HISTONE H2A.1 4932
128 3C1C 3 C, G Histone H2A type 1 8355
129 3AZH 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
130 5B40 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
131 5CPI 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
132 4JJN 3 C, G Histone H2A.2 4932
133 3W99 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
134 3AZE 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
135 3W96 3 C, G Histone H2A type 1-B/E UNP residues 11-130 9606 3.2.1.21 | Details
136 6OM3 3 C, G, O, S Histone H2A 8355
137 5XM1 3 C, G Histone H2A type 1-B 10090
138 6K1J 3 C, G Histone H2AX 9606
139 5CPJ 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
140 5B24 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
141 2HIO 1 A PROTEIN (HISTONE H2A) 9031
142 4QLC 5 C, G Histone H2A 7227
143 4LD9 3 C, G Histone H2A 8355
144 3O62 3 C, G Histone H2A type 1 8355
145 6KXV 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
146 4XUJ 3 C, G Histone H2A UNP residues 2-126 8355
147 3W97 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
148 4YM5 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
149 4YM6 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
150 2FJ7 5 C, G histone H2A 8355
151 3W98 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
152 4ZUX 3 C, G, M, Q Histone H2A type 1 8355
153 3AN2 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
154 6VYP 3 C, G, c, g Histone H2A type 1 8355
155 3B6F 5 C, G Histone H2A 8355
156 5OY7 4 C, G, K, O, S, W, a, e Histone H2A 8355
157 3B6G 5 C, G Histone H2A 8355
158 5NL0 3 C, G, M Histone H2A type 1 The core histones in the uploaded coordinates are those from X. laevis while those in the crystal are human. The reason for the discrepancy is that the structure was solved using pdb 3UT9 as a molecular replacement template (because it had the same 601L DNA sequence and therefore was the closest high-res structure available). 8355
159 3KXB 3 C, G Histone H2A 8355
160 5HQ2 3 G Histone H2A 8355
161 6HKT 3 0, 2, C, G, M, Q, W, c, g, m, q, w Histone H2A type 1-B/E THE 3 N-TERMINAL RESIDUES (GSH) COME FROM THE EXPRESSION TAG 9606 3.2.1.21 | Details
162 5OXV 3 C, G, M, Q Histone H2A 8355
163 1ZBB 5 C, G, c, g Histone H2A.1 8355
164 6YOV 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
165 6LTJ 3 C, G Histone H2A type 1 8355
166 6VEN 3 C, G Histone H2A type 1 8355
167 6V92 25 c, g Histone H2A type 1-B/E 9606 3.2.1.21 | Details
168 6TEM 3 C, G Histone H2A 8355
169 6TDA 3 C, G Histone H2A 8355
170 6UXW 3 T, X Histone H2A type 1 8355
171 6T9L 3 C, G Histone H2A 8355
172 6T90 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
173 6T93 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
174 6UPH 3 C, G Histone H2A 28985
175 6UPK 3 C Histone H2A 9606
176 6UPL 3 C, K Histone H2A 9606
177 6L49 3 C, G, M, Q, U, Y Histone H2A type 1-B/E 9606 3.2.1.21 | Details
178 6L4A 3 C, G, M, Q, U, Y Histone H2A type 1-B/E 9606 3.2.1.21 | Details
179 6KW4 3 O, S Histone H2A 8355
180 6KW3 3 O, S Histone H2A 8355
181 6SEG 3 C, G Histone H2A type 2-A 9606
182 6SE0 3 C Histone H2A type 2-A 9606
183 6SE0 5 G Histone H2A type 2-A 9606
184 6SE6 3 C, G Histone H2A type 2-A 9606
185 6SEE 3 C, G Histone H2A type 2-A 9606
186 6SEF 3 C, G Histone H2A type 2-A 9606
187 6PWV 6 I, M Histone H2A type 1 8355
188 6PWW 6 I, M Histone H2A type 1 8355
189 6PWX 4 I, M Histone H2A type 1 8355
190 6PWE 3 C, G Histone H2A 7227
191 6PWF 3 C, G Histone H2A 7227
192 6KIU 3 C, G Histone H2A 8355
193 6KIV 3 C, G Histone H2A 8355
194 6KIW 3 C, G Histone H2A 8355
195 6KIX 3 C, G Histone H2A 8355
196 6KIZ 3 C, G Histone H2A 8355
197 6S01 3 C, G Histone H2A 8355
198 6RYU 3 C, G Histone H2A type 1 8355
199 6PA7 3 C, G Histone H2A type 1 8355
200 6RYR 3 C, G Histone H2A type 1 8355
201 6K1P 3 C, G Histone H2A 8355
202 6RNY 3 C, G Histone H2A type 1 9606
203 6JYL 3 C, G Histone H2A 8355
204 6R8Y 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
205 6R8Z 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
206 6R90 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
207 6R91 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
208 6R92 6 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
209 6R93 5 C, G Histone H2A type 1-B/E GSHMSGRGKQGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLPNIQAVLLPKKTESHHKAKGK 9606 3.2.1.21 | Details
210 6R94 5 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
211 6R1U 3 C, G Histone H2A 8355
212 6R25 6 C, G Histone H2A 8355
213 6O96 3 C, G Histone H2A 8355
214 6R0C 3 C, G Histone H2A type 1 9606
215 6O1D 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
216 6J99 3 C, G Histone H2A 8355
217 6NQA 4 C, G Histone H2A type 1 8355
218 6NOG 3 C, G Histone H2A type 1 8355
219 6NN6 3 C, G Histone H2A type 1 8355
220 6J4W 21 c, g Histone H2A type 1-B/E 9606 3.2.1.21 | Details
221 6J4X 21 c, g Histone H2A type 1-B/E 9606 3.2.1.21 | Details
222 6J4Y 21 c, g Histone H2A type 1-B/E 9606 3.2.1.21 | Details
223 6J4Z 20 c, g Histone H2A type 1-B/E 9606 3.2.1.21 | Details
224 6J50 20 c, g Histone H2A type 1-B/E 9606 3.2.1.21 | Details
225 6J51 21 c, g Histone H2A type 1-B/E 9606 3.2.1.21 | Details
226 6NJ9 2 C, G Histone H2A type 1 8355
227 6NE3 3 C, G Histone H2A type 1 8355
228 6I84 2 Q, V Histone H2A type 1 8355
229 6IRO 4 C, G Histone H2A 8355
230 6IR9 21 c, g Histone H2A type 1-B/E 9606 3.2.1.21 | Details
231 6INQ 18 c, g Histone H2A type 1-B/E 9606 3.2.1.21 | Details
232 6HTS 7 K, O Histone H2A type 1-B/E 9606 3.2.1.21 | Details
233 6E0C 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
234 6E0P 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
235 6DZT 3 C, G Histone H2A 7227
236 6A5O 18 c, g Histone H2A type 1-B/E 9606 3.2.1.21 | Details
237 6A5P 18 c, g Histone H2A type 1-B/E 9606 3.2.1.21 | Details
238 6A5R 18 c, g Histone H2A type 1-B/E 9606 3.2.1.21 | Details
239 6A5T 18 c, g Histone H2A type 1-B/E 9606 3.2.1.21 | Details
240 6A5U 18 c, g Histone H2A, Histone H2A type 1-B/E 9606 3.2.1.21 | Details
241 6A5L 18 c, g Histone H2A type 1-B/E 9606 3.2.1.21 | Details
242 6GEN 4 E, F Histone H2A.1 4932
243 6GEJ 4 E, F Histone H2A.1 4932
244 6G0L 3 C Histone H2A type 1 8355
245 6G0L 5 G Histone H2A type 1 8355
246 6FTX 3 C, G Histone H2A type 1 8355
247 6FML 11 O, S Histone H2A type 1 9606
248 5Z3L 3 C, G Histone H2A 8355
249 5Z3O 3 C, G Histone H2A 8355
250 5Z3U 4 C, G Histone H2A 8355
251 5Z3V 4 C, G Histone H2A 8355
252 6C0W 3 C, G Histone H2A 9606
253 6BUZ 3 C, G Histone H2A 9606 3.2.1.21 | Details
254 6ESF 3 C, G Histone H2A 8355
255 6ESG 3 C, G Histone H2A 8355
256 6ESH 3 C, G Histone H2A 8355
257 6ESI 3 C, G Histone H2A 8355
258 5O9G 3 C, G Histone H2A 8355
259 5X0X 3 C, G Histone H2A 8355
260 5X0Y 3 C, G Histone H2A 8355
261 5KGF 3 C, G Histone H2A type 1 Isopeptide amide crosslink between K15 of H2A and G76 of ubiquitin 9606
262 2RVQ 1 C Histone H2A type 1-B/E 9606 3.2.1.21 | Details
263 3C9K 1 A, E Histone H2A-IV 9031