6SE6

Class2 : CENP-A nucleosome in complex with CENP-C central region


Sequence Similarity Clusters for the Entities in PDB 6SE6

Entity #1 | Chains: A,E
Histone H3-like centromeric protein A protein, length: 140 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 8 11 3439
95 % 8 14 3116
90 % 9 16 2743
70 % 8 11 4353
50 % 211 289 81
40 % 211 289 97
30 % 211 289 97
Entity #2 | Chains: B,F
Histone H4 protein, length: 103 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 190 269 20
95 % 212 294 26
90 % 219 303 20
70 % 220 302 34
50 % 220 302 74
40 % 220 302 91
30 % 220 302 93
Entity #3 | Chains: C,G
Histone H2A type 2-A protein, length: 130 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 4 6 9196
95 % 184 268 38
90 % 171 245 68
70 % 184 263 53
50 % 197 276 85
40 % 197 276 102
30 % 197 276 101
Entity #4 | Chains: D,H
Histone H2B type 1-C/E/F/G/I protein, length: 126 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 6 13 2490
95 % 147 183 87
90 % 187 264 45
70 % 195 275 51
50 % 200 282 83
40 % 200 282 100
30 % 200 282 100
Entity #5 | Chains: I
DNA (145-MER) dna, length: 145 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
Entity #6 | Chains: J
DNA (145-MER) dna, length: 145 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
Entity #7 | Chains: V
Centromere protein C protein, length: 124 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 3 37832
95 % 1 3 30423
90 % 1 3 29331
70 % 1 3 26400
50 % 1 3 23124
40 % 1 3 21140
30 % 1 3 18933

Instructions

In the table for each entity, view a list of similar sequences by selecting the link associated with the percentage cutoff.



View more detailed documentation on the redundancy reduction and sequence clustering procedure used by RCSB PDB.

You can also use the structure comparison tool to compare any 2 given structures


ACTION - (A) Select for download / view details OR (B) Select two chains for comparison
Rank PDB ID Entity ID Chains Description Details Taxonomy EC Number
1 1TZY 1 A, E Histone H2A-IV 9031
2 1KX5 5 C, G histone H2A.1 8355
3 2ARO 1 A, E Histone H2A-IV 9031
4 5B0Z 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
5 5Y0D 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
6 5Y0C 4 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
7 1S32 4 C, G histone H2A 8355
8 5AV8 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
9 1KX3 4 C, G histone H2A.1 8355
10 5AV9 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
11 5AV6 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
12 1HQ3 1 A, E HISTONE H2A-IV 9031
13 3UTA 3 C, G Histone H2A 8355
14 6KVD 4 C, G Histone H2A.J 9606
15 5X7X 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
16 5B31 3 C Histone H2A type 1-B/E 9606 3.2.1.21 | Details
17 5B1L 3 C, G Histone H2A type 1 10090
18 3UTB 3 C, G Histone H2A 8355
19 1M19 4 C, G Histone H2A.1 8355
20 5AVB 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
21 5AVC 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
22 5AV5 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
23 3C1B 3 C, G Histone H2A type 1 8355
24 5B1M 3 C, G Histone H2A type 1 10090
25 5OMX 5 C, G Histone H2A 8355
26 6JR1 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
27 5F99 3 C, G Histone H2A type 1 8355
28 5JRG 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
29 3UT9 3 C, G Histone H2A 8355
30 5B32 3 C Histone H2A type 1-B/E 9606 3.2.1.21 | Details
31 4WU8 5 C, G Histone H2A type 1 8355
32 1P3I 4 C, G Histone H2A 8355
33 3MGR 3 C, G Histone H2A UNP RESIDUES 2-120 8355
34 3AZG 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
35 1M18 4 C, G Histone H2A.1 8355
36 5B2J 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
37 1P3L 4 C, G Histone H2A 8355
38 1EQZ 2 A, E PROTEIN (HISTONE H2A) SUBUNIT OF SALT-EXTRACTED HISTONE OCTAMER 9031
39 5B0Y 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
40 6JR0 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
41 2CV5 4 C, G Histone H2A.a 9606 3.2.1.21 | Details
42 5CP6 5 C, G Histone H2A 8355
43 5ZBX 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
44 5XF6 3 C, G Histone H2A 8355
45 3MGP 3 C, G Histone H2A UNP RESIDUES 2-120 8355
46 3MVD 3 C, G Histone H2A 8355
47 4J8U 3 C, G Histone H2A type 1 8355
48 4WU9 3 C, G Histone H2A type 1 8355
49 3REH 3 C, G Histone H2A type 1 8355
50 3AZL 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
51 6N1Z 2 B, E Histone H2A HISTONE H2A 8355
52 3AFA 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
53 5E5A 4 C, G Histone H2A 8355
54 3REJ 3 C, G Histone H2A type 1 8355
55 3AZF 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
56 5GTC 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
57 1P3P 4 C, G Histone H2A 8355
58 3AV1 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
59 1M1A 4 C, G Histone H2A.1 8355
60 5CPK 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
61 5AY8 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
62 3MNN 3 C, G Histone H2A 8355
63 1P3G 4 C, G Histone H2A 8355
64 4J8W 3 C, G Histone H2A 8355
65 1P34 4 C, G Histone H2A 8355
66 5XF3 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
67 3X1V 4 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
68 5ONG 5 C, G Histone H2A 8355
69 5ONW 5 C, G Histone H2A 8355
70 5DNM 3 C, G Histone H2A 8355
71 3MGQ 3 C, G Histone H2A UNP RESIDUES 2-120 8355
72 3WTP 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
73 3X1T 4 C, G Histone H2A 10090
74 2NZD 5 C, G histone H2A 8355
75 3A6N 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
76 5DNN 3 C, G Histone H2A 8355
77 5GT3 3 C, G Histone H2A type 1-D 9606
78 5GT0 3 C, G Histone H2A type 1-A 9606
79 3LJA 3 C, G Histone H2A 8355
80 3AZI 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
81 3TU4 3 C, G Histone H2A 8355
82 1P3O 4 C, G Histone H2A 8355
83 1KX4 4 C, G histone H2A.1 8355
84 3AZN 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
85 1P3M 4 C, G Histone H2A 8355
86 4J8V 3 C, G Histone H2A 8355
87 3X1S 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
88 3LZ0 3 C, G Histone H2A residues 2-120 8355
89 1P3F 4 C, G Histone H2A 8355
90 1P3K 4 C, G Histone H2A 8355
91 5B2I 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
92 1P3A 4 C, G Histone H2A 8355
93 3LZ1 3 C, G Histone H2A residues 2-120 8355
94 5GXQ 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
95 4Z5T 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
96 5XM0 3 C, G Histone H2A type 1-B 10090
97 3AV2 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
98 3AYW 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
99 5XF5 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
100 3AZJ 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
101 3REK 3 C, G Histone H2A type1 8355
102 4KGC 3 C, G Histone H2A 8355
103 1ZLA 4 C, G Xenopus laevis-like histone H2A 263730
104 5GSU 3 C, G Histone H2A type 1-A 9606
105 5XF4 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
106 3REL 3 C, G Histone H2A 8355
107 5GSE 3 C, G, M Histone H2A type 1-B/E 9606 3.2.1.21 | Details
108 3REI 3 C, G Histone H2A type1 8355
109 1P3B 4 C, G Histone H2A 8355
110 3WKJ 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
111 3AZK 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
112 4J8X 3 C, G Histone H2A 8355
113 3LEL 3 C, G, M, Q Histone H2A 8355
114 3KUY 3 C, G Histone H2A 8355
115 4R8P 3 C, G Histone H2A 8355
116 3AZM 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
117 3X1U 4 C, G Histone H2A 10090
118 3MGS 3 C, G Histone H2A UNP RESIDUES 2-120 8355
119 3C1C 3 C, G Histone H2A type 1 8355
120 3AZH 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
121 5B40 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
122 5CPI 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
123 3W99 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
124 3AZE 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
125 3W96 3 C, G Histone H2A type 1-B/E UNP residues 11-130 9606 3.2.1.21 | Details
126 6OM3 3 C, G, O, S Histone H2A 8355
127 5XM1 3 C, G Histone H2A type 1-B 10090
128 5CPJ 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
129 5B24 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
130 2HIO 1 A PROTEIN (HISTONE H2A) 9031
131 4LD9 3 C, G Histone H2A 8355
132 3O62 3 C, G Histone H2A type 1 8355
133 6KXV 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
134 4XUJ 3 C, G Histone H2A UNP residues 2-126 8355
135 3W97 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
136 4YM5 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
137 4YM6 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
138 2FJ7 5 C, G histone H2A 8355
139 3W98 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
140 4ZUX 3 C, G, M, Q Histone H2A type 1 8355
141 3AN2 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
142 6VYP 3 C, G, c, g Histone H2A type 1 8355
143 3B6F 5 C, G Histone H2A 8355
144 5OY7 4 C, G, K, O, S, W, a, e Histone H2A 8355
145 3B6G 5 C, G Histone H2A 8355
146 5NL0 3 C, G, M Histone H2A type 1 The core histones in the uploaded coordinates are those from X. laevis while those in the crystal are human. The reason for the discrepancy is that the structure was solved using pdb 3UT9 as a molecular replacement template (because it had the same 601L DNA sequence and therefore was the closest high-res structure available). 8355
147 3KXB 3 C, G Histone H2A 8355
148 5HQ2 3 G Histone H2A 8355
149 6HKT 3 0, 2, C, G, M, Q, W, c, g, m, q, w Histone H2A type 1-B/E THE 3 N-TERMINAL RESIDUES (GSH) COME FROM THE EXPRESSION TAG 9606 3.2.1.21 | Details
150 5OXV 3 C, G, M, Q Histone H2A 8355
151 1ZBB 5 C, G, c, g Histone H2A.1 8355
152 6YOV 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
153 6LTJ 3 C, G Histone H2A type 1 8355
154 6VEN 3 C, G Histone H2A type 1 8355
155 6V92 25 c, g Histone H2A type 1-B/E 9606 3.2.1.21 | Details
156 6TEM 3 C, G Histone H2A 8355
157 6TDA 3 C, G Histone H2A 8355
158 6UXW 3 T, X Histone H2A type 1 8355
159 6T9L 3 C, G Histone H2A 8355
160 6T90 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
161 6T93 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
162 6UPK 3 C Histone H2A 9606
163 6UPL 3 C, K Histone H2A 9606
164 6L49 3 C, G, M, Q, U, Y Histone H2A type 1-B/E 9606 3.2.1.21 | Details
165 6L4A 3 C, G, M, Q, U, Y Histone H2A type 1-B/E 9606 3.2.1.21 | Details
166 6KW4 3 O, S Histone H2A 8355
167 6KW3 3 O, S Histone H2A 8355
168 6SEG 3 C, G Histone H2A type 2-A 9606
169 6SE0 3 C Histone H2A type 2-A 9606
170 6SE0 5 G Histone H2A type 2-A 9606
171 6SE6 3 C, G Histone H2A type 2-A 9606
172 6SEE 3 C, G Histone H2A type 2-A 9606
173 6SEF 3 C, G Histone H2A type 2-A 9606
174 6PWV 6 I, M Histone H2A type 1 8355
175 6PWW 6 I, M Histone H2A type 1 8355
176 6PWX 4 I, M Histone H2A type 1 8355
177 6KIU 3 C, G Histone H2A 8355
178 6KIV 3 C, G Histone H2A 8355
179 6KIW 3 C, G Histone H2A 8355
180 6KIX 3 C, G Histone H2A 8355
181 6KIZ 3 C, G Histone H2A 8355
182 6S01 3 C, G Histone H2A 8355
183 6RYU 3 C, G Histone H2A type 1 8355
184 6PA7 3 C, G Histone H2A type 1 8355
185 6RYR 3 C, G Histone H2A type 1 8355
186 6K1P 3 C, G Histone H2A 8355
187 6RNY 3 C, G Histone H2A type 1 9606
188 6JYL 3 C, G Histone H2A 8355
189 6R8Y 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
190 6R8Z 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
191 6R90 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
192 6R91 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
193 6R92 6 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
194 6R93 5 C, G Histone H2A type 1-B/E GSHMSGRGKQGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLPNIQAVLLPKKTESHHKAKGK 9606 3.2.1.21 | Details
195 6R94 5 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
196 6R1U 3 C, G Histone H2A 8355
197 6R25 6 C, G Histone H2A 8355
198 6O96 3 C, G Histone H2A 8355
199 6R0C 3 C, G Histone H2A type 1 9606
200 6O1D 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
201 6J99 3 C, G Histone H2A 8355
202 6NQA 4 C, G Histone H2A type 1 8355
203 6NOG 3 C, G Histone H2A type 1 8355
204 6NN6 3 C, G Histone H2A type 1 8355
205 6J4W 21 c, g Histone H2A type 1-B/E 9606 3.2.1.21 | Details
206 6J4X 21 c, g Histone H2A type 1-B/E 9606 3.2.1.21 | Details
207 6J4Y 21 c, g Histone H2A type 1-B/E 9606 3.2.1.21 | Details
208 6J4Z 20 c, g Histone H2A type 1-B/E 9606 3.2.1.21 | Details
209 6J50 20 c, g Histone H2A type 1-B/E 9606 3.2.1.21 | Details
210 6J51 21 c, g Histone H2A type 1-B/E 9606 3.2.1.21 | Details
211 6NJ9 2 C, G Histone H2A type 1 8355
212 6NE3 3 C, G Histone H2A type 1 8355
213 6I84 2 Q, V Histone H2A type 1 8355
214 6IRO 4 C, G Histone H2A 8355
215 6IR9 21 c, g Histone H2A type 1-B/E 9606 3.2.1.21 | Details
216 6INQ 18 c, g Histone H2A type 1-B/E 9606 3.2.1.21 | Details
217 6HTS 7 K, O Histone H2A type 1-B/E 9606 3.2.1.21 | Details
218 6E0C 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
219 6E0P 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
220 6A5O 18 c, g Histone H2A type 1-B/E 9606 3.2.1.21 | Details
221 6A5P 18 c, g Histone H2A type 1-B/E 9606 3.2.1.21 | Details
222 6A5R 18 c, g Histone H2A type 1-B/E 9606 3.2.1.21 | Details
223 6A5T 18 c, g Histone H2A type 1-B/E 9606 3.2.1.21 | Details
224 6A5U 18 c, g Histone H2A, Histone H2A type 1-B/E 9606 3.2.1.21 | Details
225 6A5L 18 c, g Histone H2A type 1-B/E 9606 3.2.1.21 | Details
226 6G0L 3 C Histone H2A type 1 8355
227 6G0L 5 G Histone H2A type 1 8355
228 6FTX 3 C, G Histone H2A type 1 8355
229 6FML 11 O, S Histone H2A type 1 9606
230 5Z3L 3 C, G Histone H2A 8355
231 5Z3O 3 C, G Histone H2A 8355
232 5Z3U 4 C, G Histone H2A 8355
233 5Z3V 4 C, G Histone H2A 8355
234 6C0W 3 C, G Histone H2A 9606
235 6BUZ 3 C, G Histone H2A 9606 3.2.1.21 | Details
236 6ESF 3 C, G Histone H2A 8355
237 6ESG 3 C, G Histone H2A 8355
238 6ESH 3 C, G Histone H2A 8355
239 6ESI 3 C, G Histone H2A 8355
240 5O9G 3 C, G Histone H2A 8355
241 5X0X 3 C, G Histone H2A 8355
242 5X0Y 3 C, G Histone H2A 8355
243 5KGF 3 C, G Histone H2A type 1 Isopeptide amide crosslink between K15 of H2A and G76 of ubiquitin 9606
244 2RVQ 1 C Histone H2A type 1-B/E 9606 3.2.1.21 | Details
245 3C9K 1 A, E Histone H2A-IV 9031