Sequence Similarity Clusters for the Entities in PDB 6SE6

Entity #1 | Chains: A,E
Histone H3-like centromeric protein A protein, length: 140 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 7 10 3681
95 % 7 13 3282
90 % 8 15 2830
70 % 7 10 4634
50 % 193 269 81
40 % 193 269 99
30 % 193 269 98
Entity #2 | Chains: B,F
Histone H4 protein, length: 103 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 174 251 24
95 % 193 273 33
90 % 200 282 36
70 % 201 281 46
50 % 201 281 78
40 % 201 281 96
30 % 201 281 94
Entity #3 | Chains: C,G
Histone H2A type 2-A protein, length: 130 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 4 6 8485
95 % 171 253 37
90 % 164 236 65
70 % 174 251 58
50 % 181 258 88
40 % 181 258 104
30 % 181 258 104
Entity #4 | Chains: D,H
Histone H2B type 1-C/E/F/G/I protein, length: 126 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 6 13 2309
95 % 135 171 103
90 % 170 245 63
70 % 178 256 54
50 % 178 256 90
40 % 178 256 106
30 % 178 256 107
Entity #5 | Chains: I
DNA (145-MER) dna, length: 145 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
Entity #6 | Chains: J
DNA (145-MER) dna, length: 145 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
Entity #7 | Chains: V
Centromere protein C protein, length: 124 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 3 33709
95 % 1 3 27945
90 % 1 3 29298
70 % 1 3 24592
50 % 1 3 23296
40 % 1 3 21290
30 % 1 3 17574

Instructions

In the table for each entity, view a list of similar sequences by selecting the link associated with the percentage cutoff.



View more detailed documentation on the redundancy reduction and sequence clustering procedure used by RCSB PDB.

You can also use the structure comparison tool to compare any 2 given structures


ACTION - (A) Select for download / view details OR (B) Select two chains for comparison
Rank PDB ID Entity ID Chains Description Details Taxonomy EC Number
1 1TZY 1 A, E Histone H2A-IV 9031
2 1KX5 5 C, G histone H2A.1 8355
3 2ARO 1 A, E Histone H2A-IV 9031
4 5B0Z 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
5 5Y0D 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
6 5Y0C 4 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
7 1S32 4 C, G histone H2A 8355
8 5AV8 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
9 1KX3 4 C, G histone H2A.1 8355
10 5AV9 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
11 5AV6 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
12 1HQ3 1 A, E HISTONE H2A-IV 9031
13 3UTA 3 C, G Histone H2A 8355
14 6KVD 4 C, G Histone H2A.J 9606
15 5X7X 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
16 5B31 3 C Histone H2A type 1-B/E 9606 3.2.1.21 | Details
17 5B1L 3 C, G Histone H2A type 1 10090
18 6K1K 3 C, G Histone H2AX 9606
19 3UTB 3 C, G Histone H2A 8355
20 1M19 4 C, G Histone H2A.1 8355
21 5AVB 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
22 5AVC 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
23 5AV5 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
24 3C1B 3 C, G Histone H2A type 1 8355
25 5B1M 3 C, G Histone H2A type 1 10090
26 5OMX 5 C, G Histone H2A 8355
27 6JR1 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
28 5F99 3 C, G Histone H2A type 1 8355
29 5JRG 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
30 3UT9 3 C, G Histone H2A 8355
31 5B32 3 C Histone H2A type 1-B/E 9606 3.2.1.21 | Details
32 4WU8 5 C, G Histone H2A type 1 8355
33 1P3I 4 C, G Histone H2A 8355
34 3MGR 3 C, G Histone H2A UNP RESIDUES 2-120 8355
35 3AZG 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
36 1M18 4 C, G Histone H2A.1 8355
37 5B2J 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
38 1P3L 4 C, G Histone H2A 8355
39 1EQZ 2 A, E PROTEIN (HISTONE H2A) SUBUNIT OF SALT-EXTRACTED HISTONE OCTAMER 9031
40 5B0Y 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
41 6JR0 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
42 2CV5 4 C, G Histone H2A.a 9606 3.2.1.21 | Details
43 5CP6 5 C, G Histone H2A 8355
44 5ZBX 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
45 5XF6 3 C, G Histone H2A 8355
46 3MGP 3 C, G Histone H2A UNP RESIDUES 2-120 8355
47 3MVD 3 C, G Histone H2A 8355
48 4J8U 3 C, G Histone H2A type 1 8355
49 4WU9 3 C, G Histone H2A type 1 8355
50 3REH 3 C, G Histone H2A type 1 8355
51 3AZL 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
52 6N1Z 2 B, E Histone H2A HISTONE H2A 8355
53 3AFA 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
54 5E5A 4 C, G Histone H2A 8355
55 3REJ 3 C, G Histone H2A type 1 8355
56 3AZF 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
57 5GTC 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
58 1P3P 4 C, G Histone H2A 8355
59 3AV1 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
60 1M1A 4 C, G Histone H2A.1 8355
61 5CPK 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
62 5AY8 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
63 3MNN 3 C, G Histone H2A 8355
64 1P3G 4 C, G Histone H2A 8355
65 4J8W 3 C, G Histone H2A 8355
66 1P34 4 C, G Histone H2A 8355
67 5XF3 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
68 3X1V 4 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
69 5ONG 5 C, G Histone H2A 8355
70 5ONW 5 C, G Histone H2A 8355
71 5DNM 3 C, G Histone H2A 8355
72 6K1I 3 C, G Histone H2AX Serine at position 144 is chemically phosphorylated (actual position S139) 9606
73 3MGQ 3 C, G Histone H2A UNP RESIDUES 2-120 8355
74 3WTP 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
75 3X1T 4 C, G Histone H2A 10090
76 2NZD 5 C, G histone H2A 8355
77 3A6N 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
78 5DNN 3 C, G Histone H2A 8355
79 5GT3 3 C, G Histone H2A type 1-D 9606
80 5GT0 3 C, G Histone H2A type 1-A 9606
81 3LJA 3 C, G Histone H2A 8355
82 3AZI 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
83 3TU4 3 C, G Histone H2A 8355
84 1P3O 4 C, G Histone H2A 8355
85 1KX4 4 C, G histone H2A.1 8355
86 3AZN 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
87 1P3M 4 C, G Histone H2A 8355
88 4J8V 3 C, G Histone H2A 8355
89 3X1S 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
90 3LZ0 3 C, G Histone H2A residues 2-120 8355
91 1P3F 4 C, G Histone H2A 8355
92 1P3K 4 C, G Histone H2A 8355
93 5B2I 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
94 1P3A 4 C, G Histone H2A 8355
95 3LZ1 3 C, G Histone H2A residues 2-120 8355
96 5GXQ 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
97 4Z5T 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
98 5XM0 3 C, G Histone H2A type 1-B 10090
99 3AV2 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
100 3AYW 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
101 5XF5 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
102 3AZJ 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
103 3REK 3 C, G Histone H2A type1 8355
104 4KGC 3 C, G Histone H2A 8355
105 1ZLA 4 C, G Xenopus laevis-like histone H2A 263730
106 5GSU 3 C, G Histone H2A type 1-A 9606
107 5XF4 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
108 3REL 3 C, G Histone H2A 8355
109 5GSE 3 C, G, M Histone H2A type 1-B/E 9606 3.2.1.21 | Details
110 3REI 3 C, G Histone H2A type1 8355
111 1P3B 4 C, G Histone H2A 8355
112 3WKJ 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
113 3AZK 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
114 4J8X 3 C, G Histone H2A 8355
115 3LEL 3 C, G, M, Q Histone H2A 8355
116 3KUY 3 C, G Histone H2A 8355
117 4R8P 3 C, G Histone H2A 8355
118 3AZM 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
119 3X1U 4 C, G Histone H2A 10090
120 3MGS 3 C, G Histone H2A UNP RESIDUES 2-120 8355
121 3C1C 3 C, G Histone H2A type 1 8355
122 3AZH 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
123 5B40 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
124 5CPI 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
125 3W99 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
126 3AZE 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
127 3W96 3 C, G Histone H2A type 1-B/E UNP residues 11-130 9606 3.2.1.21 | Details
128 6OM3 3 C, G, O, S Histone H2A 8355
129 5XM1 3 C, G Histone H2A type 1-B 10090
130 6K1J 3 C, G Histone H2AX 9606
131 5CPJ 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
132 5B24 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
133 2HIO 1 A PROTEIN (HISTONE H2A) 9031
134 4LD9 3 C, G Histone H2A 8355
135 3O62 3 C, G Histone H2A type 1 8355
136 4XUJ 3 C, G Histone H2A UNP residues 2-126 8355
137 3W97 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
138 4YM5 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
139 4YM6 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
140 2FJ7 5 C, G histone H2A 8355
141 3W98 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
142 4ZUX 3 C, G, M, Q Histone H2A type 1 8355
143 3AN2 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
144 3B6F 5 C, G Histone H2A 8355
145 5OY7 4 C, G, K, O, S, W, a, e Histone H2A 8355
146 3B6G 5 C, G Histone H2A 8355
147 5NL0 3 C, G, M Histone H2A type 1 The core histones in the uploaded coordinates are those from X. laevis while those in the crystal are human. The reason for the discrepancy is that the structure was solved using pdb 3UT9 as a molecular replacement template (because it had the same 601L DNA sequence and therefore was the closest high-res structure available). 8355
148 3KXB 3 C, G Histone H2A 8355
149 5HQ2 3 G Histone H2A 8355
150 6HKT 3 0, 2, C, G, M, Q, W, c, g, m, q, w Histone H2A type 1-B/E THE 3 N-TERMINAL RESIDUES (GSH) COME FROM THE EXPRESSION TAG 9606 3.2.1.21 | Details
151 5OXV 3 C, G, M, Q Histone H2A 8355
152 1ZBB 5 C, G, c, g Histone H2A.1 8355
153 6VEN 3 C, G Histone H2A type 1 8355
154 6V92 25 c, g Histone H2A type 1-B/E 9606 3.2.1.21 | Details
155 6UPK 3 C Histone H2A 9606
156 6UPL 3 C, K Histone H2A 9606
157 6L49 3 C, G, M, Q, U, Y Histone H2A type 1-B/E 9606 3.2.1.21 | Details
158 6L4A 3 C, G, M, Q, U, Y Histone H2A type 1-B/E 9606 3.2.1.21 | Details
159 6KW4 3 O, S Histone H2A 8355
160 6KW3 3 O, S Histone H2A 8355
161 6SEG 3 C, G Histone H2A type 2-A 9606
162 6SE0 3 C Histone H2A type 2-A 9606
163 6SE0 5 G Histone H2A type 2-A 9606
164 6SE6 3 C, G Histone H2A type 2-A 9606
165 6SEE 3 C, G Histone H2A type 2-A 9606
166 6SEF 3 C, G Histone H2A type 2-A 9606
167 6PWV 6 I, M Histone H2A type 1 8355
168 6PWW 6 I, M Histone H2A type 1 8355
169 6PWX 4 I, M Histone H2A type 1 8355
170 6KIU 3 C, G Histone H2A 8355
171 6KIV 3 C, G Histone H2A 8355
172 6KIW 3 C, G Histone H2A 8355
173 6KIX 3 C, G Histone H2A 8355
174 6KIZ 3 C, G Histone H2A 8355
175 6S01 3 C, G Histone H2A 8355
176 6K1P 3 C, G Histone H2A 8355
177 6RNY 3 C, G Histone H2A type 1 9606
178 6JYL 3 C, G Histone H2A 8355
179 6R8Y 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
180 6R8Z 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
181 6R90 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
182 6R91 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
183 6R92 6 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
184 6R93 5 C, G Histone H2A type 1-B/E GSHMSGRGKQGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLPNIQAVLLPKKTESHHKAKGK 9606 3.2.1.21 | Details
185 6R94 5 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
186 6R1U 3 C, G Histone H2A 8355
187 6R25 6 C, G Histone H2A 8355
188 6O96 3 C, G Histone H2A 8355
189 6R0C 3 C, G Histone H2A type 1 9606
190 6O1D 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
191 6J99 3 C, G Histone H2A 8355
192 6NQA 4 C, G Histone H2A type 1 8355
193 6NOG 3 C, G Histone H2A type 1 8355
194 6NN6 3 C, G Histone H2A type 1 8355
195 6J4W 21 c, g Histone H2A type 1-B/E 9606 3.2.1.21 | Details
196 6J4X 21 c, g Histone H2A type 1-B/E 9606 3.2.1.21 | Details
197 6J4Y 21 c, g Histone H2A type 1-B/E 9606 3.2.1.21 | Details
198 6J4Z 20 c, g Histone H2A type 1-B/E 9606 3.2.1.21 | Details
199 6J50 20 c, g Histone H2A type 1-B/E 9606 3.2.1.21 | Details
200 6J51 21 c, g Histone H2A type 1-B/E 9606 3.2.1.21 | Details
201 6NJ9 2 C, G Histone H2A type 1 8355
202 6NE3 3 C, G Histone H2A type 1 8355
203 6I84 2 Q, V Histone H2A type 1 8355
204 6IRO 4 C, G Histone H2A 8355
205 6IR9 21 c, g Histone H2A type 1-B/E 9606 3.2.1.21 | Details
206 6INQ 18 c, g Histone H2A type 1-B/E 9606 3.2.1.21 | Details
207 6HTS 7 K, O Histone H2A type 1-B/E 9606 3.2.1.21 | Details
208 6E0C 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
209 6E0P 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
210 6A5O 18 c, g Histone H2A type 1-B/E 9606 3.2.1.21 | Details
211 6A5P 18 c, g Histone H2A type 1-B/E 9606 3.2.1.21 | Details
212 6A5R 18 c, g Histone H2A type 1-B/E 9606 3.2.1.21 | Details
213 6A5T 18 c, g Histone H2A type 1-B/E 9606 3.2.1.21 | Details
214 6A5U 18 c, g Histone H2A, Histone H2A type 1-B/E 9606 3.2.1.21 | Details
215 6A5L 18 c, g Histone H2A type 1-B/E 9606 3.2.1.21 | Details
216 6G0L 3 C Histone H2A type 1 8355
217 6G0L 5 G Histone H2A type 1 8355
218 6FTX 3 C, G Histone H2A type 1 8355
219 6FML 11 O, S Histone H2A type 1 9606
220 5Z3L 3 C, G Histone H2A 8355
221 5Z3O 3 C, G Histone H2A 8355
222 5Z3T 4 C, G Histone H2A 8355
223 5Z3U 4 C, G Histone H2A 8355
224 5Z3V 4 C, G Histone H2A 8355
225 6C0W 3 C, G Histone H2A 9606
226 6BUZ 3 C, G Histone H2A 9606 3.2.1.21 | Details
227 6ESF 3 C, G Histone H2A 8355
228 6ESG 3 C, G Histone H2A 8355
229 6ESH 3 C, G Histone H2A 8355
230 6ESI 3 C, G Histone H2A 8355
231 5O9G 3 C, G Histone H2A 8355
232 5X0X 3 C, G Histone H2A 8355
233 5X0Y 3 C, G Histone H2A 8355
234 5KGF 3 C, G Histone H2A type 1 Isopeptide amide crosslink between K15 of H2A and G76 of ubiquitin 9606
235 2RVQ 1 C Histone H2A type 1-B/E 9606 3.2.1.21 | Details
236 3C9K 1 A, E Histone H2A-IV 9031