Sequence Similarity Clusters for the Entities in PDB 6SE6

Entity #1 | Chains: A,E
Histone H3-like centromeric protein A protein, length: 140 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 7 10 3552
95 % 7 13 3104
90 % 8 15 2749
70 % 7 10 4419
50 % 185 257 87
40 % 185 257 104
30 % 185 257 103
Entity #2 | Chains: B,F
Histone H4 protein, length: 103 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 166 239 37
95 % 185 261 34
90 % 192 270 37
70 % 193 269 44
50 % 193 269 79
40 % 193 269 98
30 % 193 269 97
Entity #3 | Chains: C,G
Histone H2A type 2-A protein, length: 130 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 4 6 8563
95 % 163 241 52
90 % 156 224 70
70 % 159 230 74
50 % 159 230 99
40 % 159 230 118
30 % 159 230 119
Entity #4 | Chains: D,H
Histone H2B type 1-C/E/F/G/I protein, length: 126 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 4 11 2803
95 % 128 164 110
90 % 162 233 67
70 % 170 244 68
50 % 175 251 91
40 % 175 251 107
30 % 175 251 106
Entity #5 | Chains: I
DNA (145-MER) dna, length: 145 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
Entity #6 | Chains: J
DNA (145-MER) dna, length: 145 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
Entity #7 | Chains: V
Centromere protein C protein, length: 124 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 3 33343
95 % 1 3 27668
90 % 1 3 26682
70 % 1 3 24235
50 % 1 3 23010
40 % 1 3 21091
30 % 1 3 18889

Instructions

In the table for each entity, view a list of similar sequences by selecting the link associated with the percentage cutoff.



View more detailed documentation on the redundancy reduction and sequence clustering procedure used by RCSB PDB.

You can also use the structure comparison tool to compare any 2 given structures


ACTION - (A) Select for download / view details OR (B) Select two chains for comparison
Rank PDB ID Entity ID Chains Description Details Taxonomy EC Number
1 1TZY 1 A, E Histone H2A-IV 9031
2 1KX5 5 C, G histone H2A.1 8355
3 2ARO 1 A, E Histone H2A-IV 9031
4 5B0Z 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
5 5Y0D 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
6 5Y0C 4 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
7 1S32 4 C, G histone H2A 8355
8 5AV8 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
9 1KX3 4 C, G histone H2A.1 8355
10 5AV9 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
11 5AV6 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
12 1HQ3 1 A, E HISTONE H2A-IV 9031
13 3UTA 3 C, G Histone H2A 8355
14 5X7X 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
15 5B31 3 C Histone H2A type 1-B/E 9606 3.2.1.21 | Details
16 5B1L 3 C, G Histone H2A type 1 10090
17 3UTB 3 C, G Histone H2A 8355
18 1M19 4 C, G Histone H2A.1 8355
19 5AVB 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
20 5AVC 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
21 5AV5 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
22 3C1B 3 C, G Histone H2A type 1 8355
23 5B1M 3 C, G Histone H2A type 1 10090
24 5OMX 5 C, G Histone H2A 8355
25 6JR1 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
26 5F99 3 C, G Histone H2A type 1 8355
27 5JRG 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
28 3UT9 3 C, G Histone H2A 8355
29 5B32 3 C Histone H2A type 1-B/E 9606 3.2.1.21 | Details
30 4WU8 5 C, G Histone H2A type 1 8355
31 1P3I 4 C, G Histone H2A 8355
32 3MGR 3 C, G Histone H2A UNP RESIDUES 2-120 8355
33 3AZG 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
34 1M18 4 C, G Histone H2A.1 8355
35 5B2J 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
36 1P3L 4 C, G Histone H2A 8355
37 1EQZ 2 A, E PROTEIN (HISTONE H2A) SUBUNIT OF SALT-EXTRACTED HISTONE OCTAMER 9031
38 5B0Y 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
39 6JR0 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
40 2CV5 4 C, G Histone H2A.a 9606 3.2.1.21 | Details
41 5CP6 5 C, G Histone H2A 8355
42 5ZBX 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
43 5XF6 3 C, G Histone H2A 8355
44 3MGP 3 C, G Histone H2A UNP RESIDUES 2-120 8355
45 3MVD 3 C, G Histone H2A 8355
46 4J8U 3 C, G Histone H2A type 1 8355
47 4WU9 3 C, G Histone H2A type 1 8355
48 3REH 3 C, G Histone H2A type 1 8355
49 3AZL 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
50 6N1Z 2 B, E Histone H2A HISTONE H2A 8355
51 3AFA 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
52 5E5A 4 C, G Histone H2A 8355
53 3REJ 3 C, G Histone H2A type 1 8355
54 3AZF 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
55 5GTC 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
56 1P3P 4 C, G Histone H2A 8355
57 3AV1 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
58 1M1A 4 C, G Histone H2A.1 8355
59 5CPK 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
60 5AY8 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
61 3MNN 3 C, G Histone H2A 8355
62 1P3G 4 C, G Histone H2A 8355
63 4J8W 3 C, G Histone H2A 8355
64 1P34 4 C, G Histone H2A 8355
65 5XF3 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
66 3X1V 4 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
67 5ONG 5 C, G Histone H2A 8355
68 5ONW 5 C, G Histone H2A 8355
69 5DNM 3 C, G Histone H2A 8355
70 3MGQ 3 C, G Histone H2A UNP RESIDUES 2-120 8355
71 3WTP 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
72 3X1T 4 C, G Histone H2A 10090
73 2NZD 5 C, G histone H2A 8355
74 3A6N 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
75 5DNN 3 C, G Histone H2A 8355
76 5GT3 3 C, G Histone H2A type 1-D 9606
77 5GT0 3 C, G Histone H2A type 1-A 9606
78 3LJA 3 C, G Histone H2A 8355
79 3AZI 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
80 3TU4 3 C, G Histone H2A 8355
81 1P3O 4 C, G Histone H2A 8355
82 1KX4 4 C, G histone H2A.1 8355
83 3AZN 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
84 1P3M 4 C, G Histone H2A 8355
85 4J8V 3 C, G Histone H2A 8355
86 3X1S 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
87 3LZ0 3 C, G Histone H2A residues 2-120 8355
88 1P3F 4 C, G Histone H2A 8355
89 1P3K 4 C, G Histone H2A 8355
90 5B2I 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
91 1P3A 4 C, G Histone H2A 8355
92 3LZ1 3 C, G Histone H2A residues 2-120 8355
93 5GXQ 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
94 4Z5T 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
95 5XM0 3 C, G Histone H2A type 1-B 10090
96 3AV2 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
97 3AYW 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
98 5XF5 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
99 3AZJ 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
100 3REK 3 C, G Histone H2A type1 8355
101 4KGC 3 C, G Histone H2A 8355
102 1ZLA 4 C, G Xenopus laevis-like histone H2A 263730
103 5GSU 3 C, G Histone H2A type 1-A 9606
104 5XF4 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
105 3REL 3 C, G Histone H2A 8355
106 5GSE 3 C, G, M Histone H2A type 1-B/E 9606 3.2.1.21 | Details
107 3REI 3 C, G Histone H2A type1 8355
108 1P3B 4 C, G Histone H2A 8355
109 3WKJ 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
110 3AZK 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
111 4J8X 3 C, G Histone H2A 8355
112 3LEL 3 C, G, M, Q Histone H2A 8355
113 3KUY 3 C, G Histone H2A 8355
114 4R8P 3 C, G Histone H2A 8355
115 3AZM 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
116 3X1U 4 C, G Histone H2A 10090
117 3MGS 3 C, G Histone H2A UNP RESIDUES 2-120 8355
118 3C1C 3 C, G Histone H2A type 1 8355
119 3AZH 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
120 5B40 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
121 5CPI 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
122 3W99 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
123 3AZE 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
124 3W96 3 C, G Histone H2A type 1-B/E UNP residues 11-130 9606 3.2.1.21 | Details
125 6OM3 3 C, G, O, S Histone H2A 8355
126 5XM1 3 C, G Histone H2A type 1-B 10090
127 5CPJ 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
128 5B24 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
129 2HIO 1 A PROTEIN (HISTONE H2A) 9031
130 4LD9 3 C, G Histone H2A 8355
131 3O62 3 C, G Histone H2A type 1 8355
132 4XUJ 3 C, G Histone H2A UNP residues 2-126 8355
133 3W97 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
134 4YM5 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
135 4YM6 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
136 2FJ7 5 C, G histone H2A 8355
137 3W98 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
138 4ZUX 3 C, G, M, Q Histone H2A type 1 8355
139 3AN2 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
140 3B6F 5 C, G Histone H2A 8355
141 5OY7 4 C, G, K, O, S, W, a, e Histone H2A 8355
142 3B6G 5 C, G Histone H2A 8355
143 5NL0 3 C, G, M Histone H2A type 1 The core histones in the uploaded coordinates are those from X. laevis while those in the crystal are human. The reason for the discrepancy is that the structure was solved using pdb 3UT9 as a molecular replacement template (because it had the same 601L DNA sequence and therefore was the closest high-res structure available). 8355
144 3KXB 3 C, G Histone H2A 8355
145 5HQ2 3 G Histone H2A 8355
146 6HKT 3 0, 2, C, G, M, Q, W, c, g, m, q, w Histone H2A type 1-B/E THE 3 N-TERMINAL RESIDUES (GSH) COME FROM THE EXPRESSION TAG 9606 3.2.1.21 | Details
147 5OXV 3 C, G, M, Q Histone H2A 8355
148 1ZBB 5 C, G, c, g Histone H2A.1 8355
149 6L49 3 C, G, M, Q, U, Y Histone H2A type 1-B/E 9606 3.2.1.21 | Details
150 6L4A 3 C, G, M, Q, U, Y Histone H2A type 1-B/E 9606 3.2.1.21 | Details
151 6KW4 3 O, S Histone H2A 8355
152 6KW3 3 O, S Histone H2A 8355
153 6SEG 3 C, G Histone H2A type 2-A 9606
154 6SE0 3 C Histone H2A type 2-A 9606
155 6SE0 5 G Histone H2A type 2-A 9606
156 6SE6 3 C, G Histone H2A type 2-A 9606
157 6SEE 3 C, G Histone H2A type 2-A 9606
158 6SEF 3 C, G Histone H2A type 2-A 9606
159 6KIU 3 C, G Histone H2A 8355
160 6KIV 3 C, G Histone H2A 8355
161 6KIW 3 C, G Histone H2A 8355
162 6KIX 3 C, G Histone H2A 8355
163 6KIZ 3 C, G Histone H2A 8355
164 6K1P 3 C, G Histone H2A 8355
165 6RNY 3 C, G Histone H2A type 1 9606
166 6JYL 3 C, G Histone H2A 8355
167 6R8Y 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
168 6R8Z 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
169 6R90 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
170 6R91 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
171 6R92 6 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
172 6R93 5 C, G Histone H2A type 1-B/E GSHMSGRGKQGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLPNIQAVLLPKKTESHHKAKGK 9606 3.2.1.21 | Details
173 6R94 5 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
174 6R1U 3 C, G Histone H2A 8355
175 6R25 6 C, G Histone H2A 8355
176 6O96 3 C, G Histone H2A 8355
177 6R0C 3 C, G Histone H2A type 1 9606
178 6O1D 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
179 6J99 3 C, G Histone H2A 8355
180 6NQA 4 C, G Histone H2A type 1 8355
181 6NOG 3 C, G Histone H2A type 1 8355
182 6NN6 3 C, G Histone H2A type 1 8355
183 6J4W 21 c, g Histone H2A type 1-B/E 9606 3.2.1.21 | Details
184 6J4X 21 c, g Histone H2A type 1-B/E 9606 3.2.1.21 | Details
185 6J4Y 21 c, g Histone H2A type 1-B/E 9606 3.2.1.21 | Details
186 6J4Z 20 c, g Histone H2A type 1-B/E 9606 3.2.1.21 | Details
187 6J50 20 c, g Histone H2A type 1-B/E 9606 3.2.1.21 | Details
188 6J51 21 c, g Histone H2A type 1-B/E 9606 3.2.1.21 | Details
189 6NJ9 2 C, G Histone H2A type 1 8355
190 6NE3 3 C, G Histone H2A type 1 8355
191 6I84 2 Q, V Histone H2A type 1 8355
192 6IRO 4 C, G Histone H2A 8355
193 6IR9 21 c, g Histone H2A type 1-B/E 9606 3.2.1.21 | Details
194 6INQ 18 c, g Histone H2A type 1-B/E 9606 3.2.1.21 | Details
195 6HTS 7 K, O Histone H2A type 1-B/E 9606 3.2.1.21 | Details
196 6E0C 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
197 6E0P 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
198 6A5O 18 c, g Histone H2A type 1-B/E 9606 3.2.1.21 | Details
199 6A5P 18 c, g Histone H2A type 1-B/E 9606 3.2.1.21 | Details
200 6A5R 18 c, g Histone H2A type 1-B/E 9606 3.2.1.21 | Details
201 6A5T 18 c, g Histone H2A type 1-B/E 9606 3.2.1.21 | Details
202 6A5U 18 c, g Histone H2A, Histone H2A type 1-B/E 9606 3.2.1.21 | Details
203 6A5L 18 c, g Histone H2A type 1-B/E 9606 3.2.1.21 | Details
204 6G0L 3 C Histone H2A type 1 8355
205 6G0L 5 G Histone H2A type 1 8355
206 6FTX 3 C, G Histone H2A type 1 8355
207 6FML 11 O, S Histone H2A type 1 9606
208 5Z3L 3 C, G Histone H2A 8355
209 5Z3O 3 C, G Histone H2A 8355
210 5Z3T 4 C, G Histone H2A 8355
211 5Z3U 4 C, G Histone H2A 8355
212 5Z3V 4 C, G Histone H2A 8355
213 6C0W 3 C, G Histone H2A 9606
214 6BUZ 3 C, G Histone H2A 9606 3.2.1.21 | Details
215 6ESF 3 C, G Histone H2A 8355
216 6ESG 3 C, G Histone H2A 8355
217 6ESH 3 C, G Histone H2A 8355
218 6ESI 3 C, G Histone H2A 8355
219 5O9G 3 C, G Histone H2A 8355
220 5X0X 3 C, G Histone H2A 8355
221 5X0Y 3 C, G Histone H2A 8355
222 5KGF 3 C, G Histone H2A type 1 Isopeptide amide crosslink between K15 of H2A and G76 of ubiquitin 9606
223 2RVQ 1 C Histone H2A type 1-B/E 9606 3.2.1.21 | Details
224 3C9K 1 A, E Histone H2A-IV 9031