6SE6

Class2 : CENP-A nucleosome in complex with CENP-C central region


Sequence Similarity Clusters for the Entities in PDB 6SE6

Entity #1 | Chains: A,E
Histone H3-like centromeric protein A protein, length: 140 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 8 11 3748
95 % 8 14 3221
90 % 9 16 2860
70 % 8 11 4479
50 % 240 318 65
40 % 240 318 86
30 % 240 318 94
Entity #2 | Chains: B,F
Histone H4 protein, length: 103 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 220 299 9
95 % 242 324 17
90 % 249 333 19
70 % 250 332 25
50 % 250 332 58
40 % 250 332 78
30 % 250 332 81
Entity #3 | Chains: C,G
Histone H2A type 2-A protein, length: 130 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 5 7 6007
95 % 215 299 19
90 % 198 272 45
70 % 211 290 39
50 % 224 303 69
40 % 224 303 91
30 % 224 303 97
Entity #4 | Chains: D,H
Histone H2B type 1-C/E/F/G/I protein, length: 126 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 12 19 1606
95 % 169 205 75
90 % 217 294 24
70 % 225 305 31
50 % 230 312 67
40 % 230 312 88
30 % 230 312 95
Entity #5 | Chains: I
DNA (145-MER) dna, length: 145 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
Entity #6 | Chains: J
DNA (145-MER) dna, length: 145 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
Entity #7 | Chains: V
Centromere protein C protein, length: 124 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 3 38502
95 % 1 3 30652
90 % 1 3 30153
70 % 1 3 26588
50 % 1 3 23321
40 % 1 3 21317
30 % 1 3 20315

Instructions

In the table for each entity, view a list of similar sequences by selecting the link associated with the percentage cutoff.



View more detailed documentation on the redundancy reduction and sequence clustering procedure used by RCSB PDB.

You can also use the structure comparison tool to compare any 2 given structures


ACTION - (A) Select for download / view details OR (B) Select two chains for comparison
Rank PDB ID Entity ID Chains Description Details Taxonomy EC Number
1 1TZY 1 A, E Histone H2A-IV 9031
2 1KX5 5 C, G histone H2A.1 8355
3 2ARO 1 A, E Histone H2A-IV 9031
4 5B0Z 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
5 5Y0D 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
6 5Y0C 4 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
7 1S32 4 C, G histone H2A 8355
8 5AV8 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
9 1KX3 4 C, G histone H2A.1 8355
10 5AV9 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
11 5AV6 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
12 1HQ3 1 A, E HISTONE H2A-IV 9031
13 3UTA 3 C, G Histone H2A 8355
14 6KVD 4 C, G Histone H2A.J 9606
15 5X7X 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
16 5B31 3 C Histone H2A type 1-B/E 9606 3.2.1.21 | Details
17 5B1L 3 C, G Histone H2A type 1 10090
18 3UTB 3 C, G Histone H2A 8355
19 1M19 4 C, G Histone H2A.1 8355
20 5AVB 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
21 5AVC 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
22 5AV5 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
23 3C1B 3 C, G Histone H2A type 1 8355
24 5B1M 3 C, G Histone H2A type 1 10090
25 5OMX 5 C, G Histone H2A 8355
26 6JR1 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
27 5F99 3 C, G Histone H2A type 1 8355
28 5JRG 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
29 3UT9 3 C, G Histone H2A 8355
30 5B32 3 C Histone H2A type 1-B/E 9606 3.2.1.21 | Details
31 4WU8 5 C, G Histone H2A type 1 8355
32 1P3I 4 C, G Histone H2A 8355
33 3MGR 3 C, G Histone H2A UNP RESIDUES 2-120 8355
34 3AZG 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
35 1M18 4 C, G Histone H2A.1 8355
36 5B2J 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
37 6V2K 3 C, G Histone H2A 9606
38 1P3L 4 C, G Histone H2A 8355
39 1EQZ 2 A, E PROTEIN (HISTONE H2A) SUBUNIT OF SALT-EXTRACTED HISTONE OCTAMER 9031
40 5B0Y 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
41 6JR0 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
42 2CV5 4 C, G Histone H2A.a 9606 3.2.1.21 | Details
43 5CP6 5 C, G Histone H2A 8355
44 5ZBX 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
45 5XF6 3 C, G Histone H2A 8355
46 3MGP 3 C, G Histone H2A UNP RESIDUES 2-120 8355
47 3MVD 3 C, G Histone H2A 8355
48 4J8U 3 C, G Histone H2A type 1 8355
49 4WU9 3 C, G Histone H2A type 1 8355
50 3REH 3 C, G Histone H2A type 1 8355
51 3AZL 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
52 6N1Z 2 B, E Histone H2A HISTONE H2A 8355
53 3AFA 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
54 5E5A 4 C, G Histone H2A 8355
55 3REJ 3 C, G Histone H2A type 1 8355
56 3AZF 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
57 5GTC 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
58 1P3P 4 C, G Histone H2A 8355
59 3AV1 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
60 1M1A 4 C, G Histone H2A.1 8355
61 5CPK 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
62 5AY8 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
63 3MNN 3 C, G Histone H2A 8355
64 1P3G 4 C, G Histone H2A 8355
65 4J8W 3 C, G Histone H2A 8355
66 1P34 4 C, G Histone H2A 8355
67 5XF3 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
68 3X1V 4 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
69 5ONG 5 C, G Histone H2A 8355
70 5ONW 5 C, G Histone H2A 8355
71 5DNM 3 C, G Histone H2A 8355
72 3MGQ 3 C, G Histone H2A UNP RESIDUES 2-120 8355
73 3WTP 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
74 3X1T 4 C, G Histone H2A 10090
75 2NZD 5 C, G histone H2A 8355
76 3A6N 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
77 5DNN 3 C, G Histone H2A 8355
78 5GT3 3 C, G Histone H2A type 1-D 9606
79 5GT0 3 C, G Histone H2A type 1-A 9606
80 3LJA 3 C, G Histone H2A 8355
81 3AZI 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
82 3TU4 3 C, G Histone H2A 8355
83 1P3O 4 C, G Histone H2A 8355
84 1KX4 4 C, G histone H2A.1 8355
85 3AZN 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
86 1P3M 4 C, G Histone H2A 8355
87 4J8V 3 C, G Histone H2A 8355
88 3X1S 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
89 3LZ0 3 C, G Histone H2A residues 2-120 8355
90 1P3F 4 C, G Histone H2A 8355
91 1P3K 4 C, G Histone H2A 8355
92 5B2I 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
93 1P3A 4 C, G Histone H2A 8355
94 3LZ1 3 C, G Histone H2A residues 2-120 8355
95 5GXQ 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
96 4Z5T 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
97 5XM0 3 C, G Histone H2A type 1-B 10090
98 3AV2 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
99 3AYW 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
100 5XF5 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
101 3AZJ 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
102 3REK 3 C, G Histone H2A type1 8355
103 4KGC 3 C, G Histone H2A 8355
104 1ZLA 4 C, G Xenopus laevis-like histone H2A 263730
105 5GSU 3 C, G Histone H2A type 1-A 9606
106 5XF4 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
107 3REL 3 C, G Histone H2A 8355
108 5GSE 3 C, G, M Histone H2A type 1-B/E 9606 3.2.1.21 | Details
109 3REI 3 C, G Histone H2A type1 8355
110 1P3B 4 C, G Histone H2A 8355
111 3WKJ 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
112 3AZK 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
113 4J8X 3 C, G Histone H2A 8355
114 3LEL 3 C, G, M, Q Histone H2A 8355
115 3KUY 3 C, G Histone H2A 8355
116 4R8P 3 C, G Histone H2A 8355
117 3AZM 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
118 3X1U 4 C, G Histone H2A 10090
119 3MGS 3 C, G Histone H2A UNP RESIDUES 2-120 8355
120 3C1C 3 C, G Histone H2A type 1 8355
121 3AZH 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
122 5B40 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
123 5CPI 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
124 3W99 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
125 3AZE 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
126 6LA8 3 C, G, M, Q Histone H2A type 1-B/E 9606 3.2.1.21 | Details
127 3W96 3 C, G Histone H2A type 1-B/E UNP residues 11-130 9606 3.2.1.21 | Details
128 6OM3 3 C, G, O, S Histone H2A 8355
129 5XM1 3 C, G Histone H2A type 1-B 10090
130 5CPJ 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
131 6LA9 3 C, G, M, Q Histone H2A type 1-B/E 9606 3.2.1.21 | Details
132 5B24 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
133 2HIO 1 A PROTEIN (HISTONE H2A) 9031
134 4LD9 3 C, G Histone H2A 8355
135 3O62 3 C, G Histone H2A type 1 8355
136 6M44 3 C, G, M, Q Histone H2A type 1-B/E 9606 3.2.1.21 | Details
137 6KXV 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
138 4XUJ 3 C, G Histone H2A UNP residues 2-126 8355
139 3W97 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
140 4YM5 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
141 4YM6 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
142 2FJ7 5 C, G histone H2A 8355
143 3W98 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
144 4ZUX 3 C, G, M, Q Histone H2A type 1 8355
145 6M3V 3 C, G, M, Q Histone H2A type 1-B/E 9606 3.2.1.21 | Details
146 3AN2 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
147 6VYP 3 C, G, c, g Histone H2A type 1 8355
148 3B6F 5 C, G Histone H2A 8355
149 5OY7 4 C, G, K, O, S, W, a, e Histone H2A 8355
150 3B6G 5 C, G Histone H2A 8355
151 5NL0 3 C, G, M Histone H2A type 1 The core histones in the uploaded coordinates are those from X. laevis while those in the crystal are human. The reason for the discrepancy is that the structure was solved using pdb 3UT9 as a molecular replacement template (because it had the same 601L DNA sequence and therefore was the closest high-res structure available). 8355
152 3KXB 3 C, G Histone H2A 8355
153 5HQ2 3 G Histone H2A 8355
154 6HKT 3 0, 2, C, G, M, Q, W, c, g, m, q, w Histone H2A type 1-B/E THE 3 N-TERMINAL RESIDUES (GSH) COME FROM THE EXPRESSION TAG 9606 3.2.1.21 | Details
155 5OXV 3 C, G, M, Q Histone H2A 8355
156 1ZBB 5 C, G, c, g Histone H2A.1 8355
157 7K63 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
158 7K5X 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
159 7K5Y 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
160 7K60 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
161 7K61 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
162 7CRO 3 C, G Histone H2A 8355
163 7CRP 3 C, G Histone H2A 8355
164 7CRQ 3 C, G Histone H2A 8355
165 7CRR 3 C, G Histone H2A 8355
166 7A08 4 b, f Histone H2A type 1-C 9606
167 7JO9 3 C, G Histone H2A type 1 9606
168 7JOA 3 C, G Histone H2A type 1 9606
169 6XJD 3 C, G Histone H2A type 1 9606
170 6X59 3 C, G Histone H2A type 1 9606
171 6X5A 3 C, G Histone H2A type 1 9606
172 6X0N 3 C, G, c, g Histone H2A 8355
173 6WZ5 3 C, G Histone H2A 8355
174 6WZ9 3 C, G Histone H2A 8355
175 7C0M 3 C, G, c, g Histone H2A type 1-B/E 9606 3.2.1.21 | Details
176 6YOV 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
177 6Y5D 3 C, G, O, S Histone H2A type 2-A 9606
178 6LTJ 3 C, G Histone H2A type 1 8355
179 6VEN 3 C, G Histone H2A type 1 8355
180 6V92 25 c, g Histone H2A type 1-B/E 9606 3.2.1.21 | Details
181 6TEM 3 C, G Histone H2A 8355
182 6TDA 3 C, G Histone H2A 8355
183 6UXW 3 T, X Histone H2A type 1 8355
184 6T9L 3 C, G Histone H2A 8355
185 6USJ 5 C, G, M, Q Histone H2A 9606 3.2.1.21 | Details
186 6T90 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
187 6T93 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
188 6UPK 3 C Histone H2A 9606
189 6UPL 3 C, K Histone H2A 9606
190 6L49 3 C, G, M, Q, U, Y Histone H2A type 1-B/E 9606 3.2.1.21 | Details
191 6L4A 3 C, G, M, Q, U, Y Histone H2A type 1-B/E 9606 3.2.1.21 | Details
192 6KW4 3 O, S Histone H2A 8355
193 6KW5 17 O, T Histone H2A 8355
194 6KW3 3 O, S Histone H2A 8355
195 6SEG 3 C, G Histone H2A type 2-A 9606
196 6SE0 3 C Histone H2A type 2-A 9606
197 6SE0 5 G Histone H2A type 2-A 9606
198 6SE6 3 C, G Histone H2A type 2-A 9606
199 6SEE 3 C, G Histone H2A type 2-A 9606
200 6SEF 3 C, G Histone H2A type 2-A 9606
201 6PWV 6 I, M Histone H2A type 1 8355
202 6PWW 6 I, M Histone H2A type 1 8355
203 6PWX 4 I, M Histone H2A type 1 8355
204 6KIU 3 C, G Histone H2A 8355
205 6KIV 3 C, G Histone H2A 8355
206 6KIW 3 C, G Histone H2A 8355
207 6KIX 3 C, G Histone H2A 8355
208 6KIZ 3 C, G Histone H2A 8355
209 6S01 3 C, G Histone H2A 8355
210 6RYU 3 C, G Histone H2A type 1 8355
211 6PA7 3 C, G Histone H2A type 1 8355
212 6RYR 3 C, G Histone H2A type 1 8355
213 6K1P 3 C, G Histone H2A 8355
214 6RNY 3 C, G Histone H2A type 1 9606
215 6JYL 3 C, G Histone H2A 8355
216 6R8Y 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
217 6R8Z 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
218 6R90 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
219 6R91 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
220 6R92 6 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
221 6R93 5 C, G Histone H2A type 1-B/E GSHMSGRGKQGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLPNIQAVLLPKKTESHHKAKGK 9606 3.2.1.21 | Details
222 6R94 5 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
223 6R1U 3 C, G Histone H2A 8355
224 6R25 6 C, G Histone H2A 8355
225 6O96 3 C, G Histone H2A 8355
226 6R0C 3 C, G Histone H2A type 1 9606
227 6O1D 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
228 6J99 3 C, G Histone H2A 8355
229 6NQA 4 C, G Histone H2A type 1 8355
230 6NOG 3 C, G Histone H2A type 1 8355
231 6NN6 3 C, G Histone H2A type 1 8355
232 6J4W 21 c, g Histone H2A type 1-B/E 9606 3.2.1.21 | Details
233 6J4X 21 c, g Histone H2A type 1-B/E 9606 3.2.1.21 | Details
234 6J4Y 21 c, g Histone H2A type 1-B/E 9606 3.2.1.21 | Details
235 6J4Z 20 c, g Histone H2A type 1-B/E 9606 3.2.1.21 | Details
236 6J50 20 c, g Histone H2A type 1-B/E 9606 3.2.1.21 | Details
237 6J51 21 c, g Histone H2A type 1-B/E 9606 3.2.1.21 | Details
238 6NJ9 2 C, G Histone H2A type 1 8355
239 6NE3 3 C, G Histone H2A type 1 8355
240 6I84 2 Q, V Histone H2A type 1 8355
241 6IRO 4 C, G Histone H2A 8355
242 6IR9 21 c, g Histone H2A type 1-B/E 9606 3.2.1.21 | Details
243 6INQ 18 c, g Histone H2A type 1-B/E 9606 3.2.1.21 | Details
244 6HTS 7 K, O Histone H2A type 1-B/E 9606 3.2.1.21 | Details
245 6E0C 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
246 6E0P 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
247 6A5O 18 c, g Histone H2A type 1-B/E 9606 3.2.1.21 | Details
248 6A5P 18 c, g Histone H2A type 1-B/E 9606 3.2.1.21 | Details
249 6A5R 18 c, g Histone H2A type 1-B/E 9606 3.2.1.21 | Details
250 6A5T 18 c, g Histone H2A type 1-B/E 9606 3.2.1.21 | Details
251 6A5U 18 c, g Histone H2A, Histone H2A type 1-B/E 9606 3.2.1.21 | Details
252 6A5L 18 c, g Histone H2A type 1-B/E 9606 3.2.1.21 | Details
253 6G0L 3 C Histone H2A type 1 8355
254 6G0L 5 G Histone H2A type 1 8355
255 6FTX 3 C, G Histone H2A type 1 8355
256 6FML 11 O, S Histone H2A type 1 9606
257 5Z3L 3 C, G Histone H2A 8355
258 5Z3O 3 C, G Histone H2A 8355
259 5Z3U 4 C, G Histone H2A 8355
260 5Z3V 4 C, G Histone H2A 8355
261 6C0W 3 C, G Histone H2A 9606
262 6BUZ 3 C, G Histone H2A 9606 3.2.1.21 | Details
263 6ESF 3 C, G Histone H2A 8355
264 6ESG 3 C, G Histone H2A 8355
265 6ESH 3 C, G Histone H2A 8355
266 6ESI 3 C, G Histone H2A 8355
267 5O9G 3 C, G Histone H2A 8355
268 5X0X 3 C, G Histone H2A 8355
269 5X0Y 3 C, G Histone H2A 8355
270 5KGF 3 C, G Histone H2A type 1 Isopeptide amide crosslink between K15 of H2A and G76 of ubiquitin 9606
271 2RVQ 1 C Histone H2A type 1-B/E 9606 3.2.1.21 | Details
272 3C9K 1 A, E Histone H2A-IV 9031