6SE6

Class2 : CENP-A nucleosome in complex with CENP-C central region


Sequence Similarity Clusters for the Entities in PDB 6SE6

Entity #1 | Chains: A,E
Histone H3-like centromeric protein A protein, length: 140 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 8 11 3380
95 % 8 14 3017
90 % 9 16 2683
70 % 8 11 4184
50 % 211 289 81
40 % 211 289 97
30 % 211 289 97
Entity #2 | Chains: B,F
Histone H4 protein, length: 103 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 190 269 20
95 % 212 294 26
90 % 219 303 20
70 % 220 302 33
50 % 220 302 74
40 % 220 302 91
30 % 220 302 93
Entity #3 | Chains: C,G
Histone H2A type 2-A protein, length: 130 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 4 6 9144
95 % 184 268 38
90 % 171 245 66
70 % 184 263 53
50 % 197 276 84
40 % 197 276 103
30 % 197 276 101
Entity #4 | Chains: D,H
Histone H2B type 1-C/E/F/G/I protein, length: 126 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 6 13 2483
95 % 147 183 84
90 % 187 264 45
70 % 195 275 51
50 % 200 282 83
40 % 200 282 101
30 % 200 282 100
Entity #5 | Chains: I
DNA (145-MER) dna, length: 145 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
Entity #6 | Chains: J
DNA (145-MER) dna, length: 145 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
Entity #7 | Chains: V
Centromere protein C protein, length: 124 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 3 35354
95 % 1 3 29205
90 % 1 3 28133
70 % 1 3 25464
50 % 1 3 22286
40 % 1 3 20375
30 % 1 3 18247

Instructions

In the table for each entity, view a list of similar sequences by selecting the link associated with the percentage cutoff.



View more detailed documentation on the redundancy reduction and sequence clustering procedure used by RCSB PDB.

You can also use the structure comparison tool to compare any 2 given structures


ACTION - (A) Select for download / view details OR (B) Select two chains for comparison
Rank PDB ID Entity ID Chains Description Details Taxonomy EC Number
1 1TZY 1 A, E Histone H2A-IV 9031
2 1KX5 5 C, G histone H2A.1 8355
3 2ARO 1 A, E Histone H2A-IV 9031
4 5B0Z 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
5 5Y0D 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
6 5Y0C 4 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
7 1S32 4 C, G histone H2A 8355
8 6IPU 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
9 5AV8 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
10 1KX3 4 C, G histone H2A.1 8355
11 5AV9 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
12 5AV6 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
13 1HQ3 1 A, E HISTONE H2A-IV 9031
14 6KE9 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
15 3UTA 3 C, G Histone H2A 8355
16 6KVD 4 C, G Histone H2A.J 9606
17 5X7X 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
18 5B31 3 C Histone H2A type 1-B/E 9606 3.2.1.21 | Details
19 5B1L 3 C, G Histone H2A type 1 10090
20 3UTB 3 C, G Histone H2A 8355
21 1M19 4 C, G Histone H2A.1 8355
22 5AVB 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
23 5AVC 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
24 5AV5 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
25 3C1B 3 C, G Histone H2A type 1 8355
26 5B1M 3 C, G Histone H2A type 1 10090
27 6IQ4 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
28 5OMX 5 C, G Histone H2A 8355
29 6JR1 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
30 5F99 3 C, G Histone H2A type 1 8355
31 6JXD 3 C Histone H2A type 1-B/E 9606 3.2.1.21 | Details
32 6JXD 7 G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
33 5JRG 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
34 3UT9 3 C, G Histone H2A 8355
35 5B32 3 C Histone H2A type 1-B/E 9606 3.2.1.21 | Details
36 4WU8 5 C, G Histone H2A type 1 8355
37 1P3I 4 C, G Histone H2A 8355
38 3MGR 3 C, G Histone H2A UNP RESIDUES 2-120 8355
39 3AZG 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
40 1M18 4 C, G Histone H2A.1 8355
41 5B2J 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
42 1P3L 4 C, G Histone H2A 8355
43 1EQZ 2 A, E PROTEIN (HISTONE H2A) SUBUNIT OF SALT-EXTRACTED HISTONE OCTAMER 9031
44 5B0Y 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
45 6JR0 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
46 2CV5 4 C, G Histone H2A.a 9606 3.2.1.21 | Details
47 5CP6 5 C, G Histone H2A 8355
48 5ZBX 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
49 5XF6 3 C, G Histone H2A 8355
50 3MGP 3 C, G Histone H2A UNP RESIDUES 2-120 8355
51 3MVD 3 C, G Histone H2A 8355
52 4J8U 3 C, G Histone H2A type 1 8355
53 4WU9 3 C, G Histone H2A type 1 8355
54 3REH 3 C, G Histone H2A type 1 8355
55 3AZL 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
56 4XZQ 3 C, G Histone H2A residues 15-121 8355
57 6N1Z 2 B, E Histone H2A HISTONE H2A 8355
58 3AFA 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
59 5E5A 4 C, G Histone H2A 8355
60 3REJ 3 C, G Histone H2A type 1 8355
61 3AZF 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
62 5GTC 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
63 1P3P 4 C, G Histone H2A 8355
64 3AV1 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
65 1M1A 4 C, G Histone H2A.1 8355
66 5CPK 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
67 5AY8 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
68 3MNN 3 C, G Histone H2A 8355
69 1P3G 4 C, G Histone H2A 8355
70 4J8W 3 C, G Histone H2A 8355
71 1P34 4 C, G Histone H2A 8355
72 5XF3 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
73 3X1V 4 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
74 5MLU 3 C, G Histone H2A type 1 8355
75 5ONG 5 C, G Histone H2A 8355
76 5ONW 5 C, G Histone H2A 8355
77 5DNM 3 C, G Histone H2A 8355
78 4Z66 3 C, G Histone H2A 8355
79 6L9H 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
80 6LE9 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
81 3MGQ 3 C, G Histone H2A UNP RESIDUES 2-120 8355
82 3WTP 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
83 2NZD 5 C, G histone H2A 8355
84 3A6N 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
85 5DNN 3 C, G Histone H2A 8355
86 5GT3 3 C, G Histone H2A type 1-D 9606
87 3LJA 3 C, G Histone H2A 8355
88 3AZI 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
89 3TU4 3 C, G Histone H2A 8355
90 1P3O 4 C, G Histone H2A 8355
91 1KX4 4 C, G histone H2A.1 8355
92 3AZN 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
93 1P3M 4 C, G Histone H2A 8355
94 4J8V 3 C, G Histone H2A 8355
95 1AOI 4 C, G HISTONE H2A HISTONE H2A 8355
96 3X1S 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
97 3LZ0 3 C, G Histone H2A residues 2-120 8355
98 1P3F 4 C, G Histone H2A 8355
99 1P3K 4 C, G Histone H2A 8355
100 5B2I 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
101 1P3A 4 C, G Histone H2A 8355
102 3LZ1 3 C, G Histone H2A residues 2-120 8355
103 5GXQ 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
104 4Z5T 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
105 5XM0 3 C, G Histone H2A type 1-B 10090
106 3AV2 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
107 3AYW 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
108 5XF5 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
109 3AZJ 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
110 3REK 3 C, G Histone H2A type1 8355
111 4KGC 3 C, G Histone H2A 8355
112 1ZLA 4 C, G Xenopus laevis-like histone H2A 263730
113 5XF4 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
114 3REL 3 C, G Histone H2A 8355
115 5GSE 3 C, G, M Histone H2A type 1-B/E 9606 3.2.1.21 | Details
116 3REI 3 C, G Histone H2A type1 8355
117 1P3B 4 C, G Histone H2A 8355
118 3WKJ 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
119 3AZK 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
120 4J8X 3 C, G Histone H2A 8355
121 3LEL 3 C, G, M, Q Histone H2A 8355
122 4YS3 3 C, G Histone H2A residues 15-121 8355
123 3KUY 3 C, G Histone H2A 8355
124 4R8P 3 C, G Histone H2A 8355
125 3AZM 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
126 3MGS 3 C, G Histone H2A UNP RESIDUES 2-120 8355
127 3C1C 3 C, G Histone H2A type 1 8355
128 3AZH 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
129 5B40 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
130 5CPI 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
131 3W99 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
132 3AZE 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
133 3W96 3 C, G Histone H2A type 1-B/E UNP residues 11-130 9606 3.2.1.21 | Details
134 6OM3 3 C, G, O, S Histone H2A 8355
135 5XM1 3 C, G Histone H2A type 1-B 10090
136 5CPJ 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
137 5B24 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
138 2HIO 1 A PROTEIN (HISTONE H2A) 9031
139 1HIO 1 A HISTONE H2A 9031
140 4LD9 3 C, G Histone H2A 8355
141 3O62 3 C, G Histone H2A type 1 8355
142 6KXV 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
143 4XUJ 3 C, G Histone H2A UNP residues 2-126 8355
144 3W97 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
145 4YM5 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
146 4YM6 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
147 2FJ7 5 C, G histone H2A 8355
148 3W98 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
149 4ZUX 3 C, G, M, Q Histone H2A type 1 8355
150 3AN2 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
151 6VYP 3 C, G, c, g Histone H2A type 1 8355
152 3B6F 5 C, G Histone H2A 8355
153 5OY7 4 C, G, K, O, S, W, a, e Histone H2A 8355
154 3B6G 5 C, G Histone H2A 8355
155 5NL0 3 C, G, M Histone H2A type 1 The core histones in the uploaded coordinates are those from X. laevis while those in the crystal are human. The reason for the discrepancy is that the structure was solved using pdb 3UT9 as a molecular replacement template (because it had the same 601L DNA sequence and therefore was the closest high-res structure available). 8355
156 3KXB 3 C, G Histone H2A 8355
157 3KWQ 3 C, G Histone H2A UNP residues 15-121 8355
158 5G2E 2 C, G, K, O, S, W HISTONE H2A TYPE 1 8355
159 5HQ2 3 G Histone H2A 8355
160 6HKT 3 0, 2, C, G, M, Q, W, c, g, m, q, w Histone H2A type 1-B/E THE 3 N-TERMINAL RESIDUES (GSH) COME FROM THE EXPRESSION TAG 9606 3.2.1.21 | Details
161 5OXV 3 C, G, M, Q Histone H2A 8355
162 1ZBB 5 C, G, c, g Histone H2A.1 8355
163 6YOV 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
164 6LTJ 3 C, G Histone H2A type 1 8355
165 6VEN 3 C, G Histone H2A type 1 8355
166 6V92 25 c, g Histone H2A type 1-B/E 9606 3.2.1.21 | Details
167 6TEM 3 C, G Histone H2A 8355
168 6TDA 3 C, G Histone H2A 8355
169 6UXW 3 T, X Histone H2A type 1 8355
170 6T9L 3 C, G Histone H2A 8355
171 6T90 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
172 6T93 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
173 6UPK 3 C Histone H2A 9606
174 6UPL 3 C, K Histone H2A 9606
175 6L49 3 C, G, M, Q, U, Y Histone H2A type 1-B/E 9606 3.2.1.21 | Details
176 6L4A 3 C, G, M, Q, U, Y Histone H2A type 1-B/E 9606 3.2.1.21 | Details
177 6UGM 3 C, G Histone H2A 8355
178 6UH5 3 C, G Histone H2A 8355
179 6KW4 3 O, S Histone H2A 8355
180 6KW3 3 O, S Histone H2A 8355
181 6SEG 3 C, G Histone H2A type 2-A 9606
182 6SE0 3 C Histone H2A type 2-A 9606
183 6SE0 5 G Histone H2A type 2-A 9606
184 6SE6 3 C, G Histone H2A type 2-A 9606
185 6SEE 3 C, G Histone H2A type 2-A 9606
186 6SEF 3 C, G Histone H2A type 2-A 9606
187 6PWV 6 I, M Histone H2A type 1 8355
188 6PWW 6 I, M Histone H2A type 1 8355
189 6PWX 4 I, M Histone H2A type 1 8355
190 6KIU 3 C, G Histone H2A 8355
191 6KIV 3 C, G Histone H2A 8355
192 6KIW 3 C, G Histone H2A 8355
193 6KIX 3 C, G Histone H2A 8355
194 6KIZ 3 C, G Histone H2A 8355
195 6S01 3 C, G Histone H2A 8355
196 6RYU 3 C, G Histone H2A type 1 8355
197 6PA7 3 C, G Histone H2A type 1 8355
198 6RYR 3 C, G Histone H2A type 1 8355
199 6K1P 3 C, G Histone H2A 8355
200 6RNY 3 C, G Histone H2A type 1 9606
201 6JYL 3 C, G Histone H2A 8355
202 6R8Y 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
203 6R8Z 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
204 6R90 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
205 6R91 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
206 6R92 6 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
207 6R93 5 C, G Histone H2A type 1-B/E GSHMSGRGKQGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLPNIQAVLLPKKTESHHKAKGK 9606 3.2.1.21 | Details
208 6R94 5 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
209 6R1T 3 C, G Histone H2A 8355
210 6R1U 3 C, G Histone H2A 8355
211 6R25 6 C, G Histone H2A 8355
212 6O96 3 C, G Histone H2A 8355
213 6R0C 3 C, G Histone H2A type 1 9606
214 6JM9 5 C, G Histone H2A 8355
215 6JMA 4 C, G Histone H2A 8355
216 6O1D 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
217 6J99 3 C, G Histone H2A 8355
218 6NQA 4 C, G Histone H2A type 1 8355
219 6NOG 3 C, G Histone H2A type 1 8355
220 6NN6 3 C, G Histone H2A type 1 8355
221 6J4W 21 c, g Histone H2A type 1-B/E 9606 3.2.1.21 | Details
222 6J4X 21 c, g Histone H2A type 1-B/E 9606 3.2.1.21 | Details
223 6J4Y 21 c, g Histone H2A type 1-B/E 9606 3.2.1.21 | Details
224 6J4Z 20 c, g Histone H2A type 1-B/E 9606 3.2.1.21 | Details
225 6J50 20 c, g Histone H2A type 1-B/E 9606 3.2.1.21 | Details
226 6J51 21 c, g Histone H2A type 1-B/E 9606 3.2.1.21 | Details
227 6NJ9 2 C, G Histone H2A type 1 8355
228 6NE3 3 C, G Histone H2A type 1 8355
229 6IY2 3 C, G Histone H2A 8355
230 6IY3 3 C, G Histone H2A 8355
231 6I84 2 Q, V Histone H2A type 1 8355
232 6IRO 4 C, G Histone H2A 8355
233 6IR9 21 c, g Histone H2A type 1-B/E 9606 3.2.1.21 | Details
234 6INQ 18 c, g Histone H2A type 1-B/E 9606 3.2.1.21 | Details
235 6MUO 3 C, G Histone H2A type 1-C 9606
236 6MUP 3 C, G Histone H2A type 1-C 9606
237 6HTS 7 K, O Histone H2A type 1-B/E 9606 3.2.1.21 | Details
238 6E0C 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
239 6E0P 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
240 6A5O 18 c, g Histone H2A type 1-B/E 9606 3.2.1.21 | Details
241 6A5P 18 c, g Histone H2A type 1-B/E 9606 3.2.1.21 | Details
242 6A5R 18 c, g Histone H2A type 1-B/E 9606 3.2.1.21 | Details
243 6A5T 18 c, g Histone H2A type 1-B/E 9606 3.2.1.21 | Details
244 6A5U 18 c, g Histone H2A, Histone H2A type 1-B/E 9606 3.2.1.21 | Details
245 6A5L 18 c, g Histone H2A type 1-B/E 9606 3.2.1.21 | Details
246 6G0L 3 C Histone H2A type 1 8355
247 6G0L 5 G Histone H2A type 1 8355
248 6FTX 3 C, G Histone H2A type 1 8355
249 6FQ5 3 C, G Histone H2A 8355
250 6FQ6 3 C, G Histone H2A 8355
251 6FQ8 3 C, G Histone H2A 8355
252 6FML 11 O, S Histone H2A type 1 9606
253 5Z3L 3 C, G Histone H2A 8355
254 5Z3O 3 C, G Histone H2A 8355
255 5Z3U 4 C, G Histone H2A 8355
256 5Z3V 4 C, G Histone H2A 8355
257 6C0W 3 C, G Histone H2A 9606
258 6BUZ 3 C, G Histone H2A 9606 3.2.1.21 | Details
259 6ESF 3 C, G Histone H2A 8355
260 6ESG 3 C, G Histone H2A 8355
261 6ESH 3 C, G Histone H2A 8355
262 6ESI 3 C, G Histone H2A 8355
263 5O9G 3 C, G Histone H2A 8355
264 5X0X 3 C, G Histone H2A 8355
265 5X0Y 3 C, G Histone H2A 8355
266 5KGF 3 C, G Histone H2A type 1 Isopeptide amide crosslink between K15 of H2A and G76 of ubiquitin 9606
267 2RVQ 1 C Histone H2A type 1-B/E 9606 3.2.1.21 | Details
268 3C9K 1 A, E Histone H2A-IV 9031