6SE6

Class2 : CENP-A nucleosome in complex with CENP-C central region


Sequence Similarity Clusters for the Entities in PDB 6SE6

Entity #1 | Chains: A,E
Histone H3-like centromeric protein A protein, length: 140 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 8 11 3748
95 % 8 14 3221
90 % 9 16 2860
70 % 8 11 4479
50 % 240 318 65
40 % 240 318 86
30 % 240 318 94
Entity #2 | Chains: B,F
Histone H4 protein, length: 103 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 220 299 9
95 % 242 324 17
90 % 249 333 19
70 % 250 332 25
50 % 250 332 58
40 % 250 332 78
30 % 250 332 81
Entity #3 | Chains: C,G
Histone H2A type 2-A protein, length: 130 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 5 7 6007
95 % 215 299 19
90 % 198 272 45
70 % 211 290 39
50 % 224 303 69
40 % 224 303 91
30 % 224 303 97
Entity #4 | Chains: D,H
Histone H2B type 1-C/E/F/G/I protein, length: 126 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 12 19 1606
95 % 169 205 75
90 % 217 294 24
70 % 225 305 31
50 % 230 312 67
40 % 230 312 88
30 % 230 312 95
Entity #5 | Chains: I
DNA (145-MER) dna, length: 145 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
Entity #6 | Chains: J
DNA (145-MER) dna, length: 145 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
Entity #7 | Chains: V
Centromere protein C protein, length: 124 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 3 38502
95 % 1 3 30652
90 % 1 3 30153
70 % 1 3 26588
50 % 1 3 23321
40 % 1 3 21317
30 % 1 3 20315

Instructions

In the table for each entity, view a list of similar sequences by selecting the link associated with the percentage cutoff.



View more detailed documentation on the redundancy reduction and sequence clustering procedure used by RCSB PDB.

You can also use the structure comparison tool to compare any 2 given structures


ACTION - (A) Select for download / view details OR (B) Select two chains for comparison
Rank PDB ID Entity ID Chains Description Details Taxonomy EC Number
1 1TZY 1 A, E Histone H2A-IV 9031
2 1KX5 5 C, G histone H2A.1 8355
3 2ARO 1 A, E Histone H2A-IV 9031
4 5B0Z 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
5 5Y0D 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
6 5Y0C 4 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
7 1S32 4 C, G histone H2A 8355
8 6IPU 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
9 5AV8 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
10 1KX3 4 C, G histone H2A.1 8355
11 5AV9 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
12 5AV6 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
13 1HQ3 1 A, E HISTONE H2A-IV 9031
14 6KE9 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
15 3UTA 3 C, G Histone H2A 8355
16 6KVD 4 C, G Histone H2A.J 9606
17 5X7X 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
18 5B31 3 C Histone H2A type 1-B/E 9606 3.2.1.21 | Details
19 5B1L 3 C, G Histone H2A type 1 10090
20 3UTB 3 C, G Histone H2A 8355
21 1M19 4 C, G Histone H2A.1 8355
22 5AVB 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
23 5AVC 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
24 5AV5 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
25 3C1B 3 C, G Histone H2A type 1 8355
26 5B1M 3 C, G Histone H2A type 1 10090
27 6IQ4 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
28 5OMX 5 C, G Histone H2A 8355
29 6JR1 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
30 5F99 3 C, G Histone H2A type 1 8355
31 6JXD 3 C Histone H2A type 1-B/E 9606 3.2.1.21 | Details
32 6JXD 7 G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
33 5JRG 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
34 3UT9 3 C, G Histone H2A 8355
35 5B32 3 C Histone H2A type 1-B/E 9606 3.2.1.21 | Details
36 4WU8 5 C, G Histone H2A type 1 8355
37 1P3I 4 C, G Histone H2A 8355
38 3MGR 3 C, G Histone H2A UNP RESIDUES 2-120 8355
39 3AZG 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
40 1M18 4 C, G Histone H2A.1 8355
41 5B2J 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
42 6V2K 3 C, G Histone H2A 9606
43 1P3L 4 C, G Histone H2A 8355
44 1EQZ 2 A, E PROTEIN (HISTONE H2A) SUBUNIT OF SALT-EXTRACTED HISTONE OCTAMER 9031
45 5B0Y 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
46 6JR0 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
47 2CV5 4 C, G Histone H2A.a 9606 3.2.1.21 | Details
48 5CP6 5 C, G Histone H2A 8355
49 5ZBX 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
50 5XF6 3 C, G Histone H2A 8355
51 3MGP 3 C, G Histone H2A UNP RESIDUES 2-120 8355
52 3MVD 3 C, G Histone H2A 8355
53 4J8U 3 C, G Histone H2A type 1 8355
54 4WU9 3 C, G Histone H2A type 1 8355
55 3REH 3 C, G Histone H2A type 1 8355
56 3AZL 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
57 4XZQ 3 C, G Histone H2A residues 15-121 8355
58 6N1Z 2 B, E Histone H2A HISTONE H2A 8355
59 3AFA 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
60 5E5A 4 C, G Histone H2A 8355
61 3REJ 3 C, G Histone H2A type 1 8355
62 3AZF 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
63 5GTC 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
64 1P3P 4 C, G Histone H2A 8355
65 3AV1 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
66 1M1A 4 C, G Histone H2A.1 8355
67 5CPK 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
68 5AY8 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
69 3MNN 3 C, G Histone H2A 8355
70 1P3G 4 C, G Histone H2A 8355
71 4J8W 3 C, G Histone H2A 8355
72 1P34 4 C, G Histone H2A 8355
73 5XF3 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
74 3X1V 4 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
75 5MLU 3 C, G Histone H2A type 1 8355
76 5ONG 5 C, G Histone H2A 8355
77 5ONW 5 C, G Histone H2A 8355
78 5DNM 3 C, G Histone H2A 8355
79 4Z66 3 C, G Histone H2A 8355
80 6L9H 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
81 6LE9 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
82 3MGQ 3 C, G Histone H2A UNP RESIDUES 2-120 8355
83 3WTP 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
84 2NZD 5 C, G histone H2A 8355
85 3A6N 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
86 5DNN 3 C, G Histone H2A 8355
87 5GT3 3 C, G Histone H2A type 1-D 9606
88 3LJA 3 C, G Histone H2A 8355
89 3AZI 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
90 3TU4 3 C, G Histone H2A 8355
91 1P3O 4 C, G Histone H2A 8355
92 1KX4 4 C, G histone H2A.1 8355
93 3AZN 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
94 1P3M 4 C, G Histone H2A 8355
95 4J8V 3 C, G Histone H2A 8355
96 1AOI 4 C, G HISTONE H2A HISTONE H2A 8355
97 3X1S 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
98 3LZ0 3 C, G Histone H2A residues 2-120 8355
99 1P3F 4 C, G Histone H2A 8355
100 1P3K 4 C, G Histone H2A 8355
101 5B2I 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
102 1P3A 4 C, G Histone H2A 8355
103 3LZ1 3 C, G Histone H2A residues 2-120 8355
104 5GXQ 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
105 4Z5T 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
106 5XM0 3 C, G Histone H2A type 1-B 10090
107 3AV2 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
108 3AYW 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
109 5XF5 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
110 3AZJ 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
111 3REK 3 C, G Histone H2A type1 8355
112 4KGC 3 C, G Histone H2A 8355
113 1ZLA 4 C, G Xenopus laevis-like histone H2A 263730
114 5XF4 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
115 3REL 3 C, G Histone H2A 8355
116 5GSE 3 C, G, M Histone H2A type 1-B/E 9606 3.2.1.21 | Details
117 3REI 3 C, G Histone H2A type1 8355
118 1P3B 4 C, G Histone H2A 8355
119 3WKJ 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
120 3AZK 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
121 4J8X 3 C, G Histone H2A 8355
122 3LEL 3 C, G, M, Q Histone H2A 8355
123 4YS3 3 C, G Histone H2A residues 15-121 8355
124 3KUY 3 C, G Histone H2A 8355
125 4R8P 3 C, G Histone H2A 8355
126 3AZM 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
127 3MGS 3 C, G Histone H2A UNP RESIDUES 2-120 8355
128 3C1C 3 C, G Histone H2A type 1 8355
129 3AZH 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
130 5B40 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
131 5CPI 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
132 3W99 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
133 3AZE 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
134 6LA8 3 C, G, M, Q Histone H2A type 1-B/E 9606 3.2.1.21 | Details
135 3W96 3 C, G Histone H2A type 1-B/E UNP residues 11-130 9606 3.2.1.21 | Details
136 6OM3 3 C, G, O, S Histone H2A 8355
137 5XM1 3 C, G Histone H2A type 1-B 10090
138 5CPJ 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
139 6LA9 3 C, G, M, Q Histone H2A type 1-B/E 9606 3.2.1.21 | Details
140 5B24 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
141 2HIO 1 A PROTEIN (HISTONE H2A) 9031
142 1HIO 1 A HISTONE H2A 9031
143 4LD9 3 C, G Histone H2A 8355
144 3O62 3 C, G Histone H2A type 1 8355
145 6M44 3 C, G, M, Q Histone H2A type 1-B/E 9606 3.2.1.21 | Details
146 6KXV 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
147 4XUJ 3 C, G Histone H2A UNP residues 2-126 8355
148 3W97 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
149 4YM5 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
150 4YM6 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
151 2FJ7 5 C, G histone H2A 8355
152 3W98 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
153 4ZUX 3 C, G, M, Q Histone H2A type 1 8355
154 6M3V 3 C, G, M, Q Histone H2A type 1-B/E 9606 3.2.1.21 | Details
155 3AN2 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
156 6VYP 3 C, G, c, g Histone H2A type 1 8355
157 3B6F 5 C, G Histone H2A 8355
158 5OY7 4 C, G, K, O, S, W, a, e Histone H2A 8355
159 3B6G 5 C, G Histone H2A 8355
160 5NL0 3 C, G, M Histone H2A type 1 The core histones in the uploaded coordinates are those from X. laevis while those in the crystal are human. The reason for the discrepancy is that the structure was solved using pdb 3UT9 as a molecular replacement template (because it had the same 601L DNA sequence and therefore was the closest high-res structure available). 8355
161 3KXB 3 C, G Histone H2A 8355
162 3KWQ 3 C, G Histone H2A UNP residues 15-121 8355
163 5G2E 2 C, G, K, O, S, W HISTONE H2A TYPE 1 8355
164 5HQ2 3 G Histone H2A 8355
165 6HKT 3 0, 2, C, G, M, Q, W, c, g, m, q, w Histone H2A type 1-B/E THE 3 N-TERMINAL RESIDUES (GSH) COME FROM THE EXPRESSION TAG 9606 3.2.1.21 | Details
166 5OXV 3 C, G, M, Q Histone H2A 8355
167 1ZBB 5 C, G, c, g Histone H2A.1 8355
168 7K63 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
169 7K5X 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
170 7K5Y 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
171 7K60 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
172 7K61 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
173 7CRO 3 C, G Histone H2A 8355
174 7CRP 3 C, G Histone H2A 8355
175 7CRQ 3 C, G Histone H2A 8355
176 7CRR 3 C, G Histone H2A 8355
177 7A08 4 b, f Histone H2A type 1-C 9606
178 7JO9 3 C, G Histone H2A type 1 9606
179 7JOA 3 C, G Histone H2A type 1 9606
180 6XJD 3 C, G Histone H2A type 1 9606
181 7CCQ 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
182 7CCR 3 C, G, N, R Histone H2A type 1-B/E 9606 3.2.1.21 | Details
183 6X59 3 C, G Histone H2A type 1 9606
184 6X5A 3 C, G Histone H2A type 1 9606
185 6X0N 3 C, G, c, g Histone H2A 8355
186 6WZ5 3 C, G Histone H2A 8355
187 6WZ9 3 C, G Histone H2A 8355
188 7C0M 3 C, G, c, g Histone H2A type 1-B/E 9606 3.2.1.21 | Details
189 6YOV 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
190 6Y5D 3 C, G, O, S Histone H2A type 2-A 9606
191 6Y5E 3 C Histone H2A type 2-C 9606
192 6Y5E 6 G Histone H2A type 2-C 9606
193 6LTJ 3 C, G Histone H2A type 1 8355
194 6VEN 3 C, G Histone H2A type 1 8355
195 6V92 25 c, g Histone H2A type 1-B/E 9606 3.2.1.21 | Details
196 6TEM 3 C, G Histone H2A 8355
197 6TDA 3 C, G Histone H2A 8355
198 6UXW 3 T, X Histone H2A type 1 8355
199 6T9L 3 C, G Histone H2A 8355
200 6USJ 5 C, G, M, Q Histone H2A 9606 3.2.1.21 | Details
201 6T90 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
202 6T93 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
203 6UPK 3 C Histone H2A 9606
204 6UPL 3 C, K Histone H2A 9606
205 6L49 3 C, G, M, Q, U, Y Histone H2A type 1-B/E 9606 3.2.1.21 | Details
206 6L4A 3 C, G, M, Q, U, Y Histone H2A type 1-B/E 9606 3.2.1.21 | Details
207 6UGM 3 C, G Histone H2A 8355
208 6UH5 3 C, G Histone H2A 8355
209 6KW4 3 O, S Histone H2A 8355
210 6KW5 17 O, T Histone H2A 8355
211 6KW3 3 O, S Histone H2A 8355
212 6SEG 3 C, G Histone H2A type 2-A 9606
213 6SE0 3 C Histone H2A type 2-A 9606
214 6SE0 5 G Histone H2A type 2-A 9606
215 6SE6 3 C, G Histone H2A type 2-A 9606
216 6SEE 3 C, G Histone H2A type 2-A 9606
217 6SEF 3 C, G Histone H2A type 2-A 9606
218 6PWV 6 I, M Histone H2A type 1 8355
219 6PWW 6 I, M Histone H2A type 1 8355
220 6PWX 4 I, M Histone H2A type 1 8355
221 6KIU 3 C, G Histone H2A 8355
222 6KIV 3 C, G Histone H2A 8355
223 6KIW 3 C, G Histone H2A 8355
224 6KIX 3 C, G Histone H2A 8355
225 6KIZ 3 C, G Histone H2A 8355
226 6S01 3 C, G Histone H2A 8355
227 6RYU 3 C, G Histone H2A type 1 8355
228 6PA7 3 C, G Histone H2A type 1 8355
229 6RYR 3 C, G Histone H2A type 1 8355
230 6K1P 3 C, G Histone H2A 8355
231 6RNY 3 C, G Histone H2A type 1 9606
232 6JYL 3 C, G Histone H2A 8355
233 6R8Y 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
234 6R8Z 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
235 6R90 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
236 6R91 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
237 6R92 6 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
238 6R93 5 C, G Histone H2A type 1-B/E GSHMSGRGKQGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLPNIQAVLLPKKTESHHKAKGK 9606 3.2.1.21 | Details
239 6R94 5 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
240 6R1T 3 C, G Histone H2A 8355
241 6R1U 3 C, G Histone H2A 8355
242 6R25 6 C, G Histone H2A 8355
243 6O96 3 C, G Histone H2A 8355
244 6R0C 3 C, G Histone H2A type 1 9606
245 6JM9 5 C, G Histone H2A 8355
246 6JMA 4 C, G Histone H2A 8355
247 6O1D 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
248 6J99 3 C, G Histone H2A 8355
249 6NQA 4 C, G Histone H2A type 1 8355
250 6NOG 3 C, G Histone H2A type 1 8355
251 6NN6 3 C, G Histone H2A type 1 8355
252 6J4W 21 c, g Histone H2A type 1-B/E 9606 3.2.1.21 | Details
253 6J4X 21 c, g Histone H2A type 1-B/E 9606 3.2.1.21 | Details
254 6J4Y 21 c, g Histone H2A type 1-B/E 9606 3.2.1.21 | Details
255 6J4Z 20 c, g Histone H2A type 1-B/E 9606 3.2.1.21 | Details
256 6J50 20 c, g Histone H2A type 1-B/E 9606 3.2.1.21 | Details
257 6J51 21 c, g Histone H2A type 1-B/E 9606 3.2.1.21 | Details
258 6NJ9 2 C, G Histone H2A type 1 8355
259 6NE3 3 C, G Histone H2A type 1 8355
260 6IY2 3 C, G Histone H2A 8355
261 6IY3 3 C, G Histone H2A 8355
262 6I84 2 Q, V Histone H2A type 1 8355
263 6IRO 4 C, G Histone H2A 8355
264 6IR9 21 c, g Histone H2A type 1-B/E 9606 3.2.1.21 | Details
265 6INQ 18 c, g Histone H2A type 1-B/E 9606 3.2.1.21 | Details
266 6MUO 3 C, G Histone H2A type 1-C 9606
267 6MUP 3 C, G Histone H2A type 1-C 9606
268 6HTS 7 K, O Histone H2A type 1-B/E 9606 3.2.1.21 | Details
269 6E0C 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
270 6E0P 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
271 6A5O 18 c, g Histone H2A type 1-B/E 9606 3.2.1.21 | Details
272 6A5P 18 c, g Histone H2A type 1-B/E 9606 3.2.1.21 | Details
273 6A5R 18 c, g Histone H2A type 1-B/E 9606 3.2.1.21 | Details
274 6A5T 18 c, g Histone H2A type 1-B/E 9606 3.2.1.21 | Details
275 6A5U 18 c, g Histone H2A, Histone H2A type 1-B/E 9606 3.2.1.21 | Details
276 6A5L 18 c, g Histone H2A type 1-B/E 9606 3.2.1.21 | Details
277 6G0L 3 C Histone H2A type 1 8355
278 6G0L 5 G Histone H2A type 1 8355
279 6FTX 3 C, G Histone H2A type 1 8355
280 6FQ5 3 C, G Histone H2A 8355
281 6FQ6 3 C, G Histone H2A 8355
282 6FQ8 3 C, G Histone H2A 8355
283 6FML 11 O, S Histone H2A type 1 9606
284 5Z3L 3 C, G Histone H2A 8355
285 5Z3O 3 C, G Histone H2A 8355
286 5Z3U 4 C, G Histone H2A 8355
287 5Z3V 4 C, G Histone H2A 8355
288 6C0W 3 C, G Histone H2A 9606
289 6BUZ 3 C, G Histone H2A 9606 3.2.1.21 | Details
290 6ESF 3 C, G Histone H2A 8355
291 6ESG 3 C, G Histone H2A 8355
292 6ESH 3 C, G Histone H2A 8355
293 6ESI 3 C, G Histone H2A 8355
294 5O9G 3 C, G Histone H2A 8355
295 5X0X 3 C, G Histone H2A 8355
296 5X0Y 3 C, G Histone H2A 8355
297 5KGF 3 C, G Histone H2A type 1 Isopeptide amide crosslink between K15 of H2A and G76 of ubiquitin 9606
298 2RVQ 1 C Histone H2A type 1-B/E 9606 3.2.1.21 | Details
299 3C9K 1 A, E Histone H2A-IV 9031