Sequence Similarity Clusters for the Entities in PDB 6SE6

Entity #1 | Chains: A,E
Histone H3-like centromeric protein A protein, length: 140 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 7 10 3681
95 % 7 13 3282
90 % 8 15 2830
70 % 7 10 4634
50 % 193 269 81
40 % 193 269 99
30 % 193 269 98
Entity #2 | Chains: B,F
Histone H4 protein, length: 103 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 174 251 24
95 % 193 273 33
90 % 200 282 36
70 % 201 281 46
50 % 201 281 78
40 % 201 281 96
30 % 201 281 94
Entity #3 | Chains: C,G
Histone H2A type 2-A protein, length: 130 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 4 6 8485
95 % 171 253 37
90 % 164 236 65
70 % 174 251 58
50 % 181 258 88
40 % 181 258 104
30 % 181 258 104
Entity #4 | Chains: D,H
Histone H2B type 1-C/E/F/G/I protein, length: 126 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 6 13 2309
95 % 135 171 103
90 % 170 245 63
70 % 178 256 54
50 % 178 256 90
40 % 178 256 106
30 % 178 256 107
Entity #5 | Chains: I
DNA (145-MER) dna, length: 145 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
Entity #6 | Chains: J
DNA (145-MER) dna, length: 145 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
Entity #7 | Chains: V
Centromere protein C protein, length: 124 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 3 33709
95 % 1 3 27945
90 % 1 3 29298
70 % 1 3 24592
50 % 1 3 23296
40 % 1 3 21290
30 % 1 3 17574

Instructions

In the table for each entity, view a list of similar sequences by selecting the link associated with the percentage cutoff.



View more detailed documentation on the redundancy reduction and sequence clustering procedure used by RCSB PDB.

You can also use the structure comparison tool to compare any 2 given structures


ACTION - (A) Select for download / view details OR (B) Select two chains for comparison
Rank PDB ID Entity ID Chains Description Details Taxonomy EC Number
1 1TZY 1 A, E Histone H2A-IV 9031
2 1KX5 5 C, G histone H2A.1 8355
3 2ARO 1 A, E Histone H2A-IV 9031
4 5B0Z 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
5 5Y0D 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
6 5Y0C 4 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
7 1S32 4 C, G histone H2A 8355
8 6IPU 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
9 5AV8 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
10 1KX3 4 C, G histone H2A.1 8355
11 5AV9 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
12 5AV6 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
13 1HQ3 1 A, E HISTONE H2A-IV 9031
14 3UTA 3 C, G Histone H2A 8355
15 6KVD 4 C, G Histone H2A.J 9606
16 5X7X 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
17 5B31 3 C Histone H2A type 1-B/E 9606 3.2.1.21 | Details
18 5B1L 3 C, G Histone H2A type 1 10090
19 3UTB 3 C, G Histone H2A 8355
20 1M19 4 C, G Histone H2A.1 8355
21 5AVB 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
22 5AVC 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
23 5AV5 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
24 3C1B 3 C, G Histone H2A type 1 8355
25 5B1M 3 C, G Histone H2A type 1 10090
26 6IQ4 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
27 5OMX 5 C, G Histone H2A 8355
28 6JR1 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
29 5F99 3 C, G Histone H2A type 1 8355
30 6JXD 3 C Histone H2A type 1-B/E 9606 3.2.1.21 | Details
31 6JXD 7 G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
32 5JRG 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
33 3UT9 3 C, G Histone H2A 8355
34 5B32 3 C Histone H2A type 1-B/E 9606 3.2.1.21 | Details
35 4WU8 5 C, G Histone H2A type 1 8355
36 1P3I 4 C, G Histone H2A 8355
37 3MGR 3 C, G Histone H2A UNP RESIDUES 2-120 8355
38 3AZG 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
39 1M18 4 C, G Histone H2A.1 8355
40 5B2J 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
41 1P3L 4 C, G Histone H2A 8355
42 1EQZ 2 A, E PROTEIN (HISTONE H2A) SUBUNIT OF SALT-EXTRACTED HISTONE OCTAMER 9031
43 5B0Y 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
44 6JR0 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
45 2CV5 4 C, G Histone H2A.a 9606 3.2.1.21 | Details
46 5CP6 5 C, G Histone H2A 8355
47 5ZBX 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
48 5XF6 3 C, G Histone H2A 8355
49 3MGP 3 C, G Histone H2A UNP RESIDUES 2-120 8355
50 3MVD 3 C, G Histone H2A 8355
51 4J8U 3 C, G Histone H2A type 1 8355
52 4WU9 3 C, G Histone H2A type 1 8355
53 3REH 3 C, G Histone H2A type 1 8355
54 3AZL 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
55 4XZQ 3 C, G Histone H2A residues 15-121 8355
56 6N1Z 2 B, E Histone H2A HISTONE H2A 8355
57 3AFA 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
58 5E5A 4 C, G Histone H2A 8355
59 3REJ 3 C, G Histone H2A type 1 8355
60 3AZF 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
61 5GTC 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
62 1P3P 4 C, G Histone H2A 8355
63 3AV1 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
64 1M1A 4 C, G Histone H2A.1 8355
65 5CPK 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
66 5AY8 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
67 3MNN 3 C, G Histone H2A 8355
68 1P3G 4 C, G Histone H2A 8355
69 4J8W 3 C, G Histone H2A 8355
70 1P34 4 C, G Histone H2A 8355
71 5XF3 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
72 3X1V 4 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
73 5MLU 3 C, G Histone H2A type 1 8355
74 5ONG 5 C, G Histone H2A 8355
75 5ONW 5 C, G Histone H2A 8355
76 5DNM 3 C, G Histone H2A 8355
77 4Z66 3 C, G Histone H2A 8355
78 3MGQ 3 C, G Histone H2A UNP RESIDUES 2-120 8355
79 3WTP 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
80 2NZD 5 C, G histone H2A 8355
81 3A6N 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
82 5DNN 3 C, G Histone H2A 8355
83 5GT3 3 C, G Histone H2A type 1-D 9606
84 3LJA 3 C, G Histone H2A 8355
85 3AZI 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
86 3TU4 3 C, G Histone H2A 8355
87 1P3O 4 C, G Histone H2A 8355
88 1KX4 4 C, G histone H2A.1 8355
89 3AZN 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
90 1P3M 4 C, G Histone H2A 8355
91 4J8V 3 C, G Histone H2A 8355
92 1AOI 4 C, G HISTONE H2A HISTONE H2A 8355
93 3X1S 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
94 3LZ0 3 C, G Histone H2A residues 2-120 8355
95 1P3F 4 C, G Histone H2A 8355
96 1P3K 4 C, G Histone H2A 8355
97 5B2I 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
98 1P3A 4 C, G Histone H2A 8355
99 3LZ1 3 C, G Histone H2A residues 2-120 8355
100 5GXQ 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
101 4Z5T 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
102 5XM0 3 C, G Histone H2A type 1-B 10090
103 3AV2 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
104 3AYW 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
105 5XF5 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
106 3AZJ 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
107 3REK 3 C, G Histone H2A type1 8355
108 4KGC 3 C, G Histone H2A 8355
109 1ZLA 4 C, G Xenopus laevis-like histone H2A 263730
110 5XF4 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
111 3REL 3 C, G Histone H2A 8355
112 5GSE 3 C, G, M Histone H2A type 1-B/E 9606 3.2.1.21 | Details
113 3REI 3 C, G Histone H2A type1 8355
114 1P3B 4 C, G Histone H2A 8355
115 3WKJ 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
116 3AZK 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
117 4J8X 3 C, G Histone H2A 8355
118 3LEL 3 C, G, M, Q Histone H2A 8355
119 4YS3 3 C, G Histone H2A residues 15-121 8355
120 3KUY 3 C, G Histone H2A 8355
121 4R8P 3 C, G Histone H2A 8355
122 3AZM 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
123 3MGS 3 C, G Histone H2A UNP RESIDUES 2-120 8355
124 3C1C 3 C, G Histone H2A type 1 8355
125 3AZH 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
126 5B40 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
127 5CPI 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
128 3W99 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
129 3AZE 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
130 3W96 3 C, G Histone H2A type 1-B/E UNP residues 11-130 9606 3.2.1.21 | Details
131 6OM3 3 C, G, O, S Histone H2A 8355
132 5XM1 3 C, G Histone H2A type 1-B 10090
133 5CPJ 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
134 5B24 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
135 2HIO 1 A PROTEIN (HISTONE H2A) 9031
136 1HIO 1 A HISTONE H2A 9031
137 4LD9 3 C, G Histone H2A 8355
138 3O62 3 C, G Histone H2A type 1 8355
139 4XUJ 3 C, G Histone H2A UNP residues 2-126 8355
140 3W97 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
141 4YM5 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
142 4YM6 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
143 2FJ7 5 C, G histone H2A 8355
144 3W98 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
145 4ZUX 3 C, G, M, Q Histone H2A type 1 8355
146 3AN2 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
147 3B6F 5 C, G Histone H2A 8355
148 5OY7 4 C, G, K, O, S, W, a, e Histone H2A 8355
149 3B6G 5 C, G Histone H2A 8355
150 5NL0 3 C, G, M Histone H2A type 1 The core histones in the uploaded coordinates are those from X. laevis while those in the crystal are human. The reason for the discrepancy is that the structure was solved using pdb 3UT9 as a molecular replacement template (because it had the same 601L DNA sequence and therefore was the closest high-res structure available). 8355
151 3KXB 3 C, G Histone H2A 8355
152 3KWQ 3 C, G Histone H2A UNP residues 15-121 8355
153 5G2E 2 C, G, K, O, S, W HISTONE H2A TYPE 1 8355
154 5HQ2 3 G Histone H2A 8355
155 6HKT 3 0, 2, C, G, M, Q, W, c, g, m, q, w Histone H2A type 1-B/E THE 3 N-TERMINAL RESIDUES (GSH) COME FROM THE EXPRESSION TAG 9606 3.2.1.21 | Details
156 5OXV 3 C, G, M, Q Histone H2A 8355
157 1ZBB 5 C, G, c, g Histone H2A.1 8355
158 6VEN 3 C, G Histone H2A type 1 8355
159 6V92 25 c, g Histone H2A type 1-B/E 9606 3.2.1.21 | Details
160 6UPK 3 C Histone H2A 9606
161 6UPL 3 C, K Histone H2A 9606
162 6L49 3 C, G, M, Q, U, Y Histone H2A type 1-B/E 9606 3.2.1.21 | Details
163 6L4A 3 C, G, M, Q, U, Y Histone H2A type 1-B/E 9606 3.2.1.21 | Details
164 6UGM 3 C, G Histone H2A 8355
165 6UH5 3 C, G Histone H2A 8355
166 6KW4 3 O, S Histone H2A 8355
167 6KW3 3 O, S Histone H2A 8355
168 6SEG 3 C, G Histone H2A type 2-A 9606
169 6SE0 3 C Histone H2A type 2-A 9606
170 6SE0 5 G Histone H2A type 2-A 9606
171 6SE6 3 C, G Histone H2A type 2-A 9606
172 6SEE 3 C, G Histone H2A type 2-A 9606
173 6SEF 3 C, G Histone H2A type 2-A 9606
174 6PWV 6 I, M Histone H2A type 1 8355
175 6PWW 6 I, M Histone H2A type 1 8355
176 6PWX 4 I, M Histone H2A type 1 8355
177 6KIU 3 C, G Histone H2A 8355
178 6KIV 3 C, G Histone H2A 8355
179 6KIW 3 C, G Histone H2A 8355
180 6KIX 3 C, G Histone H2A 8355
181 6KIZ 3 C, G Histone H2A 8355
182 6S01 3 C, G Histone H2A 8355
183 6K1P 3 C, G Histone H2A 8355
184 6RNY 3 C, G Histone H2A type 1 9606
185 6JYL 3 C, G Histone H2A 8355
186 6R8Y 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
187 6R8Z 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
188 6R90 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
189 6R91 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
190 6R92 6 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
191 6R93 5 C, G Histone H2A type 1-B/E GSHMSGRGKQGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLPNIQAVLLPKKTESHHKAKGK 9606 3.2.1.21 | Details
192 6R94 5 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
193 6R1T 3 C, G Histone H2A 8355
194 6R1U 3 C, G Histone H2A 8355
195 6R25 6 C, G Histone H2A 8355
196 6O96 3 C, G Histone H2A 8355
197 6R0C 3 C, G Histone H2A type 1 9606
198 6JM9 5 C, G Histone H2A 8355
199 6JMA 4 C, G Histone H2A 8355
200 6O1D 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
201 6J99 3 C, G Histone H2A 8355
202 6NQA 4 C, G Histone H2A type 1 8355
203 6NOG 3 C, G Histone H2A type 1 8355
204 6NN6 3 C, G Histone H2A type 1 8355
205 6J4W 21 c, g Histone H2A type 1-B/E 9606 3.2.1.21 | Details
206 6J4X 21 c, g Histone H2A type 1-B/E 9606 3.2.1.21 | Details
207 6J4Y 21 c, g Histone H2A type 1-B/E 9606 3.2.1.21 | Details
208 6J4Z 20 c, g Histone H2A type 1-B/E 9606 3.2.1.21 | Details
209 6J50 20 c, g Histone H2A type 1-B/E 9606 3.2.1.21 | Details
210 6J51 21 c, g Histone H2A type 1-B/E 9606 3.2.1.21 | Details
211 6NJ9 2 C, G Histone H2A type 1 8355
212 6NE3 3 C, G Histone H2A type 1 8355
213 6IY2 3 C, G Histone H2A 8355
214 6IY3 3 C, G Histone H2A 8355
215 6I84 2 Q, V Histone H2A type 1 8355
216 6IRO 4 C, G Histone H2A 8355
217 6IR9 21 c, g Histone H2A type 1-B/E 9606 3.2.1.21 | Details
218 6INQ 18 c, g Histone H2A type 1-B/E 9606 3.2.1.21 | Details
219 6MUO 3 C, G Histone H2A type 1-C 9606
220 6MUP 3 C, G Histone H2A type 1-C 9606
221 6HTS 7 K, O Histone H2A type 1-B/E 9606 3.2.1.21 | Details
222 6E0C 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
223 6E0P 3 C, G Histone H2A type 1-B/E 9606 3.2.1.21 | Details
224 6A5O 18 c, g Histone H2A type 1-B/E 9606 3.2.1.21 | Details
225 6A5P 18 c, g Histone H2A type 1-B/E 9606 3.2.1.21 | Details
226 6A5R 18 c, g Histone H2A type 1-B/E 9606 3.2.1.21 | Details
227 6A5T 18 c, g Histone H2A type 1-B/E 9606 3.2.1.21 | Details
228 6A5U 18 c, g Histone H2A, Histone H2A type 1-B/E 9606 3.2.1.21 | Details
229 6A5L 18 c, g Histone H2A type 1-B/E 9606 3.2.1.21 | Details
230 6G0L 3 C Histone H2A type 1 8355
231 6G0L 5 G Histone H2A type 1 8355
232 6FTX 3 C, G Histone H2A type 1 8355
233 6FQ5 3 C, G Histone H2A 8355
234 6FQ6 3 C, G Histone H2A 8355
235 6FQ8 3 C, G Histone H2A 8355
236 6FML 11 O, S Histone H2A type 1 9606
237 5Z3L 3 C, G Histone H2A 8355
238 5Z3O 3 C, G Histone H2A 8355
239 5Z3T 4 C, G Histone H2A 8355
240 5Z3U 4 C, G Histone H2A 8355
241 5Z3V 4 C, G Histone H2A 8355
242 6C0W 3 C, G Histone H2A 9606
243 6BUZ 3 C, G Histone H2A 9606 3.2.1.21 | Details
244 6ESF 3 C, G Histone H2A 8355
245 6ESG 3 C, G Histone H2A 8355
246 6ESH 3 C, G Histone H2A 8355
247 6ESI 3 C, G Histone H2A 8355
248 5O9G 3 C, G Histone H2A 8355
249 5X0X 3 C, G Histone H2A 8355
250 5X0Y 3 C, G Histone H2A 8355
251 5KGF 3 C, G Histone H2A type 1 Isopeptide amide crosslink between K15 of H2A and G76 of ubiquitin 9606
252 2RVQ 1 C Histone H2A type 1-B/E 9606 3.2.1.21 | Details
253 3C9K 1 A, E Histone H2A-IV 9031